(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01480

AM920435.PC20G01480  Location/Qualifiers
FT   CDS             join(328803..328985,329059..329673,329724..329864)
FT                   /gene="Pc20g01480"
FT                   /locus_tag="PCH_Pc20g01480"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   CAB91761.2 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01480"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85477"
FT                   /db_xref="GOA:B6HD85"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD85"
FT                   /inference="similar to AA sequence:TREMBL:NCB14D6.52"
FT                   /inference="protein motif:PFAM:PF00097"
FT                   /inference="protein motif:COGS:COG5183"
FT                   /protein_id="CAP85477.1"
FT                   /translation="MERSKEGELCCRQRWVTFGAVELTKGGDQIGISRGVWDTFGFSAF
FT                   LLLVVLFFFNPSKKETHYPPRVCRICLESVLPTFQPSEFLQKPRVVYESSDPECGRLLS
FT                   PCQCKGSSRYVHEGCLQSWRHADPKYGTRNFWQCPTCGFQYRLERLTWARWISSATTQL
FT                   ILTLGILFLTVFLLGFIADPIIDFYLGPVDVYAELVEEDVSWLGHFLKGLASLGLLSFL
FT                   KAIFALSPFPWNLRSVASGRNSGRNRAAQLNWLVVMVGIGTFLWAVYKGVRSWSRRTLE
FT                   KAGERVMDVPLPDDESDTDVPIPDDAGMKEE"
     MERSKEGELC CRQRWVTFGA VELTKGGDQI GISRGVWDTF GFSAFLLLVV LFFFNPSKKE        60
     THYPPRVCRI CLESVLPTFQ PSEFLQKPRV VYESSDPECG RLLSPCQCKG SSRYVHEGCL       120
     QSWRHADPKY GTRNFWQCPT CGFQYRLERL TWARWISSAT TQLILTLGIL FLTVFLLGFI       180
     ADPIIDFYLG PVDVYAELVE EDVSWLGHFL KGLASLGLLS FLKAIFALSP FPWNLRSVAS       240
     GRNSGRNRAA QLNWLVVMVG IGTFLWAVYK GVRSWSRRTL EKAGERVMDV PLPDDESDTD       300
     VPIPDDAGMK EE                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page