(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01500

AM920435.PC20G01500  Location/Qualifiers
FT   CDS             complement(join(331607..332321,332390..332691))
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /note="unknown EC_number=4.1.1.46"
FT                   /note="Title: strong similarity to 2,3-dihydroxybenzoic
FT                   acid decarboxylase dhbD - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85479"
FT                   /db_xref="GOA:B6HDF7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF7"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85479.1"
FT                   /translation="MLGKIALEEAFALPRFREKTKWWAGMFATDTEKHTAEINDVGPIR
FT                   LDFAERHGVGLQILSYTAPGVQDIWDAKDAQALAVEINDYIAEKVKAHPDRFAAFATLS
FT                   MHDPQEAAAELRRCVTQHGFLGALVNDTQRAGADGDDMIFYDNEKWDVFWATCTELDVP
FT                   LYLHPRNPTGTIYDKLWADRKWLIGPPLSFAQGVSLHVLGMVTNGVFDRNPKLQVILGH
FT                   LGEHIPFDMWRINHWFEDRKKMLGLGETCKRTIREYFAENLWITTSGHFSTTTLNFCMA
FT                   EVGADRILFSIDYPFETFADACDWFDSAEMSNTDRLKIGRENAKKLFKLGAYKDSTA"
     MLGKIALEEA FALPRFREKT KWWAGMFATD TEKHTAEIND VGPIRLDFAE RHGVGLQILS        60
     YTAPGVQDIW DAKDAQALAV EINDYIAEKV KAHPDRFAAF ATLSMHDPQE AAAELRRCVT       120
     QHGFLGALVN DTQRAGADGD DMIFYDNEKW DVFWATCTEL DVPLYLHPRN PTGTIYDKLW       180
     ADRKWLIGPP LSFAQGVSLH VLGMVTNGVF DRNPKLQVIL GHLGEHIPFD MWRINHWFED       240
     RKKMLGLGET CKRTIREYFA ENLWITTSGH FSTTTLNFCM AEVGADRILF SIDYPFETFA       300
     DACDWFDSAE MSNTDRLKIG RENAKKLFKL GAYKDSTA                               338
//

If you have problems or comments...

PBIL Back to PBIL home page