(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01510

AM920435.PC20G01510  Location/Qualifiers
FT   CDS             complement(join(332980..333138,333212..333559))
FT                   /gene="Pc20g01510"
FT                   /locus_tag="PCH_Pc20g01510"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An08g05278 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85480"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF8"
FT                   /protein_id="CAP85480.1"
FT                   /translation="MATRTIYLISARNTSFQRAHFSIFVPSATNPDRGTKIHAVGAPMA
FT                   GYVLEFKRNYNPSLEPHDQTFPIGQVHSSDVVDSPDAAPSIDSTPRGKIELAATQVPTP
FT                   GINQNFMAPVNDTTNKRCQEWTMEYVRHLVAKGLVDKEAIEIVQSKRDPPTHGIGLRSV
FT                   TRPGT"
     MATRTIYLIS ARNTSFQRAH FSIFVPSATN PDRGTKIHAV GAPMAGYVLE FKRNYNPSLE        60
     PHDQTFPIGQ VHSSDVVDSP DAAPSIDSTP RGKIELAATQ VPTPGINQNF MAPVNDTTNK       120
     RCQEWTMEYV RHLVAKGLVD KEAIEIVQSK RDPPTHGIGL RSVTRPGT                    168
//

If you have problems or comments...

PBIL Back to PBIL home page