(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01520

AM920435.PC20G01520  Location/Qualifiers
FT   CDS             complement(join(333826..334424,334482..334530,
FT                   334589..334879,334943..335031,335084..335168,
FT                   335222..335599))
FT                   /gene="Pc20g01520"
FT                   /locus_tag="PCH_Pc20g01520"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg07210.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85481"
FT                   /db_xref="GOA:B6HDF9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF9"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /inference="protein motif:COGS:COG2124"
FT                   /protein_id="CAP85481.1"
FT                   /translation="MLQSTLTLALASCNDFPTLRDVGSLTSVILLLLALLYKVLYVPVA
FT                   SPPRKDSPPCLRLPSWKVTQLFFEKRFDFIKDGFKATSSSIYQTSLFRHNAIVLSGDEG
FT                   RQLFFKEKGLCLYDTFSIMMGSGAAKFDPHQVGGVVRRMASIQRPDNLQKLIPLILLES
FT                   QQKMNAWGRERILDPCSSLHEVAFQLVMRIASFDIANDPVLSARLKSLVDTVDSITNPY
FT                   STWLPWLPGPALFHKFFASVQIYRIVQAAINARKRSGIKRDDMLQQMIDEGDGTIQIFG
FT                   CMLGLSLAGARATGTIVTWLIMQITSDPVWSSNVQEEVKTFVSTHTLSPSLSGDALIQA
FT                   LSEIPLTAWESQTPNLDLCIRETLRTSQPYTAVRKNIGPDVTIGPYVIPSGSLVVYPFS
FT                   DTALNPNYYPDATRWDPSRGIDKETPFIGWGGGKHACKGQRLATLSMKLMVVYALMRFD
FT                   ITMVDGQGKKINRLPLPDWNDSATCRPKERCGIKFVEK"
     MLQSTLTLAL ASCNDFPTLR DVGSLTSVIL LLLALLYKVL YVPVASPPRK DSPPCLRLPS        60
     WKVTQLFFEK RFDFIKDGFK ATSSSIYQTS LFRHNAIVLS GDEGRQLFFK EKGLCLYDTF       120
     SIMMGSGAAK FDPHQVGGVV RRMASIQRPD NLQKLIPLIL LESQQKMNAW GRERILDPCS       180
     SLHEVAFQLV MRIASFDIAN DPVLSARLKS LVDTVDSITN PYSTWLPWLP GPALFHKFFA       240
     SVQIYRIVQA AINARKRSGI KRDDMLQQMI DEGDGTIQIF GCMLGLSLAG ARATGTIVTW       300
     LIMQITSDPV WSSNVQEEVK TFVSTHTLSP SLSGDALIQA LSEIPLTAWE SQTPNLDLCI       360
     RETLRTSQPY TAVRKNIGPD VTIGPYVIPS GSLVVYPFSD TALNPNYYPD ATRWDPSRGI       420
     DKETPFIGWG GGKHACKGQR LATLSMKLMV VYALMRFDIT MVDGQGKKIN RLPLPDWNDS       480
     ATCRPKERCG IKFVEK                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page