(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01590

AM920435.PC20G01590  Location/Qualifiers
FT   CDS             complement(join(352207..352395,352500..354208,
FT                   354275..354620,354726..354911))
FT                   /gene="Pc20g01590"
FT                   /locus_tag="PCH_Pc20g01590"
FT                   /note="Title: weak similarity to protein CG33196-PB
FT                   -Drosophila melanogaster"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01590"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85488"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDG6"
FT                   /protein_id="CAP85488.1"
FT                   /translation="MASDRTIRDLFPALVVGLERETSATPSVHDSDASFHPSQSPTPVN
FT                   KQTLPAQDSIEVKAPTPTADLLLLDPHEFSLLQLKRILRTTYLQLVTLCLTIPVGAFIP
FT                   ALDPQTTNTNSNTEGRPKDASHILTPRIRVVMRKGPREPTPDSDTVSESSKKQHPKDVT
FT                   PITPRRRIVITKKSRAEGRPNEATPTSTPRVRIVVRKRSREITEDSDTVSDPTSAKGTK
FT                   DVTPIPSHSSQDSIHSTAPSDPRNPSSYLESNLLNSAEEPPVDSNMDSPKPTAVSTSHE
FT                   SSSDYDETSISVNPTSELPATSMSPNSRSSSEEAPSRDAGHLSPTLDFVPSTPPHPSSD
FT                   SSMGPPTDPSMDPNMVSHRQPLDSAVIPGNPSFEDPDVLPSTFMYPEETFDQSNRAIDP
FT                   MGVYTPEEYARILASEQEVLREMADPHTDIATHLYSQTEDPYYTTINDLNRHTDTSTHL
FT                   YSQTEEPHHTAIDDLDRHTDISTHPYSQTEEPHYTTIDDMDRIFAEMEAATAGMDFLQP
FT                   EFWAAIGRDLSSPSQPGALESDQHAQAPTTSGTLQSVEGTDLGSVPKRARHSSPKTKSP
FT                   SPDLSSTLSVKTSVSMPSRSASSKAKSTTPPAMSASNRRRSKDQSVTPAPTASSSRRRS
FT                   KASTKTETATPEPRATVTVSPRRLRSSDVMPRPSTNTKKNPQGNATPDSWDTAPTADKM
FT                   MSQMKETESMSWFDITAAWNQNRSDLDDEMTWRALSKRWGRIKDRIGPWPGFDEALLDA
FT                   FSQFNSKPDDESFAQIAEDISIQLGWDVSGAACQGRYDVLEEAGKIDLKGKGRARK"
     MASDRTIRDL FPALVVGLER ETSATPSVHD SDASFHPSQS PTPVNKQTLP AQDSIEVKAP        60
     TPTADLLLLD PHEFSLLQLK RILRTTYLQL VTLCLTIPVG AFIPALDPQT TNTNSNTEGR       120
     PKDASHILTP RIRVVMRKGP REPTPDSDTV SESSKKQHPK DVTPITPRRR IVITKKSRAE       180
     GRPNEATPTS TPRVRIVVRK RSREITEDSD TVSDPTSAKG TKDVTPIPSH SSQDSIHSTA       240
     PSDPRNPSSY LESNLLNSAE EPPVDSNMDS PKPTAVSTSH ESSSDYDETS ISVNPTSELP       300
     ATSMSPNSRS SSEEAPSRDA GHLSPTLDFV PSTPPHPSSD SSMGPPTDPS MDPNMVSHRQ       360
     PLDSAVIPGN PSFEDPDVLP STFMYPEETF DQSNRAIDPM GVYTPEEYAR ILASEQEVLR       420
     EMADPHTDIA THLYSQTEDP YYTTINDLNR HTDTSTHLYS QTEEPHHTAI DDLDRHTDIS       480
     THPYSQTEEP HYTTIDDMDR IFAEMEAATA GMDFLQPEFW AAIGRDLSSP SQPGALESDQ       540
     HAQAPTTSGT LQSVEGTDLG SVPKRARHSS PKTKSPSPDL SSTLSVKTSV SMPSRSASSK       600
     AKSTTPPAMS ASNRRRSKDQ SVTPAPTASS SRRRSKASTK TETATPEPRA TVTVSPRRLR       660
     SSDVMPRPST NTKKNPQGNA TPDSWDTAPT ADKMMSQMKE TESMSWFDIT AAWNQNRSDL       720
     DDEMTWRALS KRWGRIKDRI GPWPGFDEAL LDAFSQFNSK PDDESFAQIA EDISIQLGWD       780
     VSGAACQGRY DVLEEAGKID LKGKGRARK                                         809
//

If you have problems or comments...

PBIL Back to PBIL home page