(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01680

AM920435.PC20G01680  Location/Qualifiers
FT   CDS             complement(join(379634..379648,379701..380249,
FT                   380328..380788,380849..381109,381156..381777,
FT                   381837..381989,382046..382446,382509..382569))
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /note="unknown EC_number=3.1.4.4"
FT                   /note="Title: similarity to phospholipase Pld1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85497"
FT                   /db_xref="GOA:B6HDQ3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ3"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /inference="protein motif:COGS:COG1502"
FT                   /protein_id="CAP85497.1"
FT                   /translation="MHKFREKFEQGIDHLEESFKDAHIHDVKAEATHLKAKVGKFFNII
FT                   NPNHRHDEEHEQETDRKRSEIADSHRFKSFAPVHDGNRVKWYVDGKDYMWAVSEALEKA
FT                   TETIYIADWWLSPELFLRRPPVENQQWRLDQVLKRRAEAGVKIYIIVYKEVNQALTCNS
FT                   AHTKHALRNLCPEGTPGYGNIRVMRHPDHNIFENAADMTLYWAHHEKFIVIDYNVGFIG
FT                   GIDLCFGRWDANQHPLADVHPRGLRDDIFPGQDFNNNRIMDFQSVEDWQSNEVSKIDFG
FT                   RMPWHDVAMGLQGDCVYDIAEHFVLRWNFIKRDKYKRSHDVDWLLMEGRTGEEEDIIAV
FT                   QRPKYPCGDYVQHPLTPLSSKPRGNVGTVRAQIVRSSDDWSSGILNEHSIQNAYCETIR
FT                   NAQHYVYIENQFFITATGDQQRPIFNTIGRAIVDACVRAGKEGRKFRVIIVIPAIPGFA
FT                   GDLRDNAALGTRAIMDYQYKSICRGEHSIFGQIEKEGIDPREHVFVFALRAYDRINKTP
FT                   VLEDLEKQADVTYQDIQRGIAETIMSESVHPAVGKDGDDNEKDYAADQSAKEETLRKLQ
FT                   KFQEKVDQRKAGDGFNSKDSVAHCTMLNGGKVSEESWEGDAEAEKANFVQEELYVHGKV
FT                   CIVDDRTIICGSANINDRSQLGSHDSELAIVMEDQDLIDSKMNGQPYRASRLAATLRRQ
FT                   LWREHLGLLRAQDYDASGDPNAQPPDVSLNKIDEGPENEFVMDPLSDGVWNTWTSQATG
FT                   NTETYRMLFRADPDDHIKTFEDYDNFRPRGTRKEGHLFDPYMPAKDVREKLDLIKGHLV
FT                   WLPLDFLRDAEMAEPGLAVNQITESIYT"
     MHKFREKFEQ GIDHLEESFK DAHIHDVKAE ATHLKAKVGK FFNIINPNHR HDEEHEQETD        60
     RKRSEIADSH RFKSFAPVHD GNRVKWYVDG KDYMWAVSEA LEKATETIYI ADWWLSPELF       120
     LRRPPVENQQ WRLDQVLKRR AEAGVKIYII VYKEVNQALT CNSAHTKHAL RNLCPEGTPG       180
     YGNIRVMRHP DHNIFENAAD MTLYWAHHEK FIVIDYNVGF IGGIDLCFGR WDANQHPLAD       240
     VHPRGLRDDI FPGQDFNNNR IMDFQSVEDW QSNEVSKIDF GRMPWHDVAM GLQGDCVYDI       300
     AEHFVLRWNF IKRDKYKRSH DVDWLLMEGR TGEEEDIIAV QRPKYPCGDY VQHPLTPLSS       360
     KPRGNVGTVR AQIVRSSDDW SSGILNEHSI QNAYCETIRN AQHYVYIENQ FFITATGDQQ       420
     RPIFNTIGRA IVDACVRAGK EGRKFRVIIV IPAIPGFAGD LRDNAALGTR AIMDYQYKSI       480
     CRGEHSIFGQ IEKEGIDPRE HVFVFALRAY DRINKTPVLE DLEKQADVTY QDIQRGIAET       540
     IMSESVHPAV GKDGDDNEKD YAADQSAKEE TLRKLQKFQE KVDQRKAGDG FNSKDSVAHC       600
     TMLNGGKVSE ESWEGDAEAE KANFVQEELY VHGKVCIVDD RTIICGSANI NDRSQLGSHD       660
     SELAIVMEDQ DLIDSKMNGQ PYRASRLAAT LRRQLWREHL GLLRAQDYDA SGDPNAQPPD       720
     VSLNKIDEGP ENEFVMDPLS DGVWNTWTSQ ATGNTETYRM LFRADPDDHI KTFEDYDNFR       780
     PRGTRKEGHL FDPYMPAKDV REKLDLIKGH LVWLPLDFLR DAEMAEPGLA VNQITESIYT       840
//

If you have problems or comments...

PBIL Back to PBIL home page