(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01770

AM920435.PC20G01770  Location/Qualifiers
FT   CDS             join(403481..403584,403671..403734,403964..404036,
FT                   404134..404312)
FT                   /gene="Pc20g01770"
FT                   /locus_tag="PCH_Pc20g01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01770"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85506"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR2"
FT                   /protein_id="CAP85506.1"
FT                   /translation="MATGPPHNYPCQSTLVYLGSRTGGLISSSRLERYWDREKGASEQH
FT                   PADLLGILIHHAFICDDKDRRRSNELYDGGSRSVCVSWLIVAEDCRLEGINLHRDLTVY
FT                   HEEPQAVGDLRLGARYFVGGYLAMIEQLGNEFWGS"
     MATGPPHNYP CQSTLVYLGS RTGGLISSSR LERYWDREKG ASEQHPADLL GILIHHAFIC        60
     DDKDRRRSNE LYDGGSRSVC VSWLIVAEDC RLEGINLHRD LTVYHEEPQA VGDLRLGARY       120
     FVGGYLAMIE QLGNEFWGS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page