(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01780

AM920435.PC20G01780  Location/Qualifiers
FT   CDS             join(405825..406236,406289..406330,406462..407124,
FT                   407155..407383,407440..407737)
FT                   /gene="Pc20g01780"
FT                   /locus_tag="PCH_Pc20g01780"
FT                   /note="Title: strong similarity to high-affinity glucose
FT                   transporter HGT1 - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85507"
FT                   /db_xref="GOA:B6HDR3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR3"
FT                   /inference="similar to AA sequence:SWISSPROT:HGT1_KLULA"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85507.1"
FT                   /translation="MQTRRFLGLSGTKVQIAIGFLAGMDFLLFGYDQGVTGGLLTLDSF
FT                   VKYFPEINTLDSYTEHWSPSAKSNQSTRQGITVAAYNLGCFAGSIPTIWIGNILGRRKA
FT                   IFLGSFIMCVGAILQCTSYGLAQLVIGRLITGFGNGINTSTVPTWQSECCKSHRRGQMV
FT                   MIEGAMITCGITISYWINFGLMFADPNEVAWRFPLAFQIFFAAIILAFVMFLPESPRWL
FT                   ILKGREEEAKEVLACLMGDETDELFIDTEFTAIKATVLEMATGSFRDMFTMGEDRHFHR
FT                   TMLAYVNQMFQQISGINLITYYIPTLLEQQVGLDATISRLISACNGTEYFIASWIAVFT
FT                   VERFGRRTLMLFGAVGMSISMVVLAISDSISSTGVAQTVFLFVFNTFFAIGWLGMTWLY
FT                   PAEIVPLKIRAPANALSTSSNWIWNFMVVMITPVAFENIGYKTYIIFAVINAAIVPVVY
FT                   FFFPETTMRSLEEMDRIFRKTTSVFNVVSLANTEPHMYGPNGELLRTLDDVEDDAVRRA
FT                   SFLNKESKAQQQSHTQHAEKCSDEPTSEER"
     MQTRRFLGLS GTKVQIAIGF LAGMDFLLFG YDQGVTGGLL TLDSFVKYFP EINTLDSYTE        60
     HWSPSAKSNQ STRQGITVAA YNLGCFAGSI PTIWIGNILG RRKAIFLGSF IMCVGAILQC       120
     TSYGLAQLVI GRLITGFGNG INTSTVPTWQ SECCKSHRRG QMVMIEGAMI TCGITISYWI       180
     NFGLMFADPN EVAWRFPLAF QIFFAAIILA FVMFLPESPR WLILKGREEE AKEVLACLMG       240
     DETDELFIDT EFTAIKATVL EMATGSFRDM FTMGEDRHFH RTMLAYVNQM FQQISGINLI       300
     TYYIPTLLEQ QVGLDATISR LISACNGTEY FIASWIAVFT VERFGRRTLM LFGAVGMSIS       360
     MVVLAISDSI SSTGVAQTVF LFVFNTFFAI GWLGMTWLYP AEIVPLKIRA PANALSTSSN       420
     WIWNFMVVMI TPVAFENIGY KTYIIFAVIN AAIVPVVYFF FPETTMRSLE EMDRIFRKTT       480
     SVFNVVSLAN TEPHMYGPNG ELLRTLDDVE DDAVRRASFL NKESKAQQQS HTQHAEKCSD       540
     EPTSEER                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page