(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01800

AM920435.PC20G01800  Location/Qualifiers
FT   CDS             complement(join(412030..412710,412766..413432,
FT                   413484..413857,413918..414283))
FT                   /gene="Pc20g01800"
FT                   /locus_tag="PCH_Pc20g01800"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig42.tfa_690wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01800"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85509"
FT                   /db_xref="GOA:B6HE13"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR029320"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE13"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /inference="protein motif:PFAM:PF01756"
FT                   /inference="protein motif:COGS:COG1960"
FT                   /protein_id="CAP85509.1"
FT                   /translation="MPSPPPDWVKALKPSGPQGSELLHQERAQSNVDVERLSELLHTKE
FT                   TLERRASLLALLQPEKVFDKSQNHSLGRVERLQRSLAKAKRLQQLAEEHKWSMQELHAA
FT                   NDLIGEPTPYGLHASMFLVTLREQGTPEQHKLFLERAEKYEIIGCYAQTELGHGSNVRG
FT                   LETTATWNSNDKTFTINSPTLTASKWWIGSLGRTANHAVVMAQLFIDGKNYGPHPFVVQ
FT                   VRDLETHQPLDNVYVGDIGPKFGYNTMDNGFLLFNNVKIPHVNMLARFCQVDKETNQYA
FT                   KPAMPSLVFGTMTWVRANIVLDAGGVLARGVTIATRYCAVRRQFQDRDADPHAGETQVL
FT                   NYKMVQVRLLPLLASMYALHFTGRGMMRLYEENQSRMKAASSPDQESRGAGPEQLRAGA
FT                   NLLADLHATSCGLKALASTTAGEGLEICRRACGGHGYSSYSGIGPAYADYLPTLTWEGD
FT                   NYMLTQQVARYLLKSARAVLAGKPARNDTSQILQAYLDRRDKGASFDVLDEDKDIVAAF
FT                   GWRTAHLTFEALKHRDAEQRSWNSLLVDFWRLSTAHSQYLMVKNFYEAVSSPELSGALD
FT                   PETKGLMHQLFRLFSLHTLEREAAEFFSSGAVTVRQITLTRTTAVLKLLDDIRPHAVRL
FT                   VDAWAIPDWQLDSSLGRYDGKVYEDLFRRASEENPVNELVFDPYPWNSALLKNEPAKSK
FT                   L"
     MPSPPPDWVK ALKPSGPQGS ELLHQERAQS NVDVERLSEL LHTKETLERR ASLLALLQPE        60
     KVFDKSQNHS LGRVERLQRS LAKAKRLQQL AEEHKWSMQE LHAANDLIGE PTPYGLHASM       120
     FLVTLREQGT PEQHKLFLER AEKYEIIGCY AQTELGHGSN VRGLETTATW NSNDKTFTIN       180
     SPTLTASKWW IGSLGRTANH AVVMAQLFID GKNYGPHPFV VQVRDLETHQ PLDNVYVGDI       240
     GPKFGYNTMD NGFLLFNNVK IPHVNMLARF CQVDKETNQY AKPAMPSLVF GTMTWVRANI       300
     VLDAGGVLAR GVTIATRYCA VRRQFQDRDA DPHAGETQVL NYKMVQVRLL PLLASMYALH       360
     FTGRGMMRLY EENQSRMKAA SSPDQESRGA GPEQLRAGAN LLADLHATSC GLKALASTTA       420
     GEGLEICRRA CGGHGYSSYS GIGPAYADYL PTLTWEGDNY MLTQQVARYL LKSARAVLAG       480
     KPARNDTSQI LQAYLDRRDK GASFDVLDED KDIVAAFGWR TAHLTFEALK HRDAEQRSWN       540
     SLLVDFWRLS TAHSQYLMVK NFYEAVSSPE LSGALDPETK GLMHQLFRLF SLHTLEREAA       600
     EFFSSGAVTV RQITLTRTTA VLKLLDDIRP HAVRLVDAWA IPDWQLDSSL GRYDGKVYED       660
     LFRRASEENP VNELVFDPYP WNSALLKNEP AKSKL                                  695
//

If you have problems or comments...

PBIL Back to PBIL home page