(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01810

AM920435.PC20G01810  Location/Qualifiers
FT   CDS             complement(join(415010..415357,415405..415761,
FT                   415812..416213,416266..416280,416353..416565))
FT                   /gene="Pc20g01810"
FT                   /locus_tag="PCH_Pc20g01810"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   B15I20.50 - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85510"
FT                   /db_xref="GOA:B6HE14"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE14"
FT                   /inference="similar to AA sequence:PIR:T51035"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP85510.1"
FT                   /translation="MATTCEIQSSRDTSFIALETLPHGQSDTDSRLGPESFPLLEKWNQ
FT                   PRINIHRTFATFWSFLVMGANDAAYGALIPYLESYYHLSYTIVSLVFLSPLVGYTVAAF
FT                   LNHRIHYTLGQRGVAIIGPACHLIAYVINCIHPPYPVLVVAFIFAGLGNGLEDAAWNAW
FT                   LGNMANANELLGVLHGIYGAGAVISPLVATSMIAKGGLPWYYFYYVMTGCAAIELVVSG
FT                   ACFWKSTAADFRASNVSSADNKKGGLRNALFKRPAARVTWLCALFLLGYVGVEVALGGW
FT                   IVTFMIRVRQGGAFASGMTATGFWLGITVGRVILGFVTPRVGEKVAISVYIVCSMAFAL
FT                   VLWLVPQFYVSAVAVSLQGFFLGPLFPGVVVMVTKLLPRHLHVTSIGFVAAFGGSGAAI
FT                   LPFAVGVLAQAKGVQVLQPFIVALSGAILLTWLGLPRVSKVRHNE"
     MATTCEIQSS RDTSFIALET LPHGQSDTDS RLGPESFPLL EKWNQPRINI HRTFATFWSF        60
     LVMGANDAAY GALIPYLESY YHLSYTIVSL VFLSPLVGYT VAAFLNHRIH YTLGQRGVAI       120
     IGPACHLIAY VINCIHPPYP VLVVAFIFAG LGNGLEDAAW NAWLGNMANA NELLGVLHGI       180
     YGAGAVISPL VATSMIAKGG LPWYYFYYVM TGCAAIELVV SGACFWKSTA ADFRASNVSS       240
     ADNKKGGLRN ALFKRPAARV TWLCALFLLG YVGVEVALGG WIVTFMIRVR QGGAFASGMT       300
     ATGFWLGITV GRVILGFVTP RVGEKVAISV YIVCSMAFAL VLWLVPQFYV SAVAVSLQGF       360
     FLGPLFPGVV VMVTKLLPRH LHVTSIGFVA AFGGSGAAIL PFAVGVLAQA KGVQVLQPFI       420
     VALSGAILLT WLGLPRVSKV RHNE                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page