(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01840

AM920435.PC20G01840  Location/Qualifiers
FT   CDS             complement(join(420597..420915,420974..421326,
FT                   421396..421734))
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /note="unknown EC_number=2.5.1.1"
FT                   /note="unknown EC_number=2.5.1.10"
FT                   /note="unknown EC_number=2.5.1.29"
FT                   /note="Title: similarity to geranylgeranyl pyrophosphate
FT                   synthase GGPPS - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85513"
FT                   /db_xref="GOA:B6HE17"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17"
FT                   /inference="similar to AA sequence:TREMBL:AB016043.1"
FT                   /inference="protein motif:COGS:COG0142"
FT                   /protein_id="CAP85513.1"
FT                   /translation="MSLFGSVFGFFLRGASPILGMVAVSSFLYLIVDHIHIPRWWDKKT
FT                   HLIGRKSPERITRHECPYDYLREIYGKHHWKAFVHKLSPALHNDDPAKYSMVLEIMDAI
FT                   HLCLMLVDDISDGSDYRKGRPAAHSIYGPSETGNRAYYRVTQILNKTTKDFPNLAPWLM
FT                   QDLQDILEGQDISLIWRRDGLSAFPIATAERLAAYRRMASLKTGSLFRLLGHIVLENDS
FT                   MDETLTTVAWHSQLQNDCKNVYSSEYAKLKGSVAEDLHNREMTYPIVLALDAPDGHLVT
FT                   GALEYPSPRNIRNAMRVIRGDYVRSICTNELRKSGASVKEWLELWGRKEKLDLKA"
     MSLFGSVFGF FLRGASPILG MVAVSSFLYL IVDHIHIPRW WDKKTHLIGR KSPERITRHE        60
     CPYDYLREIY GKHHWKAFVH KLSPALHNDD PAKYSMVLEI MDAIHLCLML VDDISDGSDY       120
     RKGRPAAHSI YGPSETGNRA YYRVTQILNK TTKDFPNLAP WLMQDLQDIL EGQDISLIWR       180
     RDGLSAFPIA TAERLAAYRR MASLKTGSLF RLLGHIVLEN DSMDETLTTV AWHSQLQNDC       240
     KNVYSSEYAK LKGSVAEDLH NREMTYPIVL ALDAPDGHLV TGALEYPSPR NIRNAMRVIR       300
     GDYVRSICTN ELRKSGASVK EWLELWGRKE KLDLKA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page