(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01870

AM920435.PC20G01870  Location/Qualifiers
FT   CDS             complement(428385..428834)
FT                   /gene="Pc20g01870"
FT                   /locus_tag="PCH_Pc20g01870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1490_3.tfa_160wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85516"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE20"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /inference="protein motif:COGS:COG0251"
FT                   /protein_id="CAP85516.1"
FT                   /translation="MGSGPAKTCFATSSPYEEKIGYYRAVRHGNQIFVSGTTSVDPYSP
FT                   TNAPHVLHPEDARQQTRVALEESIRAIQGLGGKGAEDIVRVKMFVSRHEDCEAVGRGFS
FT                   EILGKHNRGGSGMIGAAATMIVVNGGFINKEMLVEIEVDAVVEYI"
     MGSGPAKTCF ATSSPYEEKI GYYRAVRHGN QIFVSGTTSV DPYSPTNAPH VLHPEDARQQ        60
     TRVALEESIR AIQGLGGKGA EDIVRVKMFV SRHEDCEAVG RGFSEILGKH NRGGSGMIGA       120
     AATMIVVNGG FINKEMLVEI EVDAVVEYI                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page