(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01880

AM920435.PC20G01880  Location/Qualifiers
FT   CDS             complement(429477..431018)
FT                   /gene="Pc20g01880"
FT                   /locus_tag="PCH_Pc20g01880"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   SC9B2.03 - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01880"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85517"
FT                   /db_xref="InterPro:IPR009197"
FT                   /db_xref="InterPro:IPR010799"
FT                   /db_xref="InterPro:IPR015995"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE21"
FT                   /inference="similar to AA sequence:PIR:T35899"
FT                   /inference="protein motif:COGS:COG5476"
FT                   /protein_id="CAP85517.1"
FT                   /translation="MSQRPVIAIAGLACETSTFSPARTLGRAFHPRRGPEIIEKYAFLH
FT                   NSTPLADVADWKGALIGHALPGGIVVRADFEQLSREILERLAAIVASNPIDGLWYDIHG
FT                   AMCVDGMEDVEAELLRRIRSVIGPNVLVSASMDLHGNVSRELAHQTDLITCYRMAPHED
FT                   ALETKERACRNLIDVLTSRTDTGCRRPLKAWVPIPILLPGEQTSTRDEPAKSLYSLVPE
FT                   IEAMENVLDAAIWVGYAWADEPRNHAVVMVTGWDKSAVTTGAKRLASLFWRVHKDFHFA
FT                   APTGSFSECIDNALASSNRPFFISDSGDNPTAGGSGDVTFGLNELLKRAEFAKETTRSV
FT                   IYASIPGPQAIDVITKAGVGTTVTVTAGAQVDNLHAGPVTMTGRIHSIRYGDPDAEIEA
FT                   VLQVGSVFTILTKFRKPYHHESDFVGLDLSPRVTNIVIVKIGYLEPELFNMAADWMIAL
FT                   TPGSVDQYLQRLGHHRILRPMWPFDKTFYRAPDLTPRLIPFSNEDLGAPQGLSLE"
     MSQRPVIAIA GLACETSTFS PARTLGRAFH PRRGPEIIEK YAFLHNSTPL ADVADWKGAL        60
     IGHALPGGIV VRADFEQLSR EILERLAAIV ASNPIDGLWY DIHGAMCVDG MEDVEAELLR       120
     RIRSVIGPNV LVSASMDLHG NVSRELAHQT DLITCYRMAP HEDALETKER ACRNLIDVLT       180
     SRTDTGCRRP LKAWVPIPIL LPGEQTSTRD EPAKSLYSLV PEIEAMENVL DAAIWVGYAW       240
     ADEPRNHAVV MVTGWDKSAV TTGAKRLASL FWRVHKDFHF AAPTGSFSEC IDNALASSNR       300
     PFFISDSGDN PTAGGSGDVT FGLNELLKRA EFAKETTRSV IYASIPGPQA IDVITKAGVG       360
     TTVTVTAGAQ VDNLHAGPVT MTGRIHSIRY GDPDAEIEAV LQVGSVFTIL TKFRKPYHHE       420
     SDFVGLDLSP RVTNIVIVKI GYLEPELFNM AADWMIALTP GSVDQYLQRL GHHRILRPMW       480
     PFDKTFYRAP DLTPRLIPFS NEDLGAPQGL SLE                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page