(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01910

AM920435.PC20G01910  Location/Qualifiers
FT   CDS             complement(436899..437900)
FT                   /gene="Pc20g01910"
FT                   /locus_tag="PCH_Pc20g01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01910"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85520"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE24"
FT                   /protein_id="CAP85520.1"
FT                   /translation="MAESRGGPSNPKFSDLVPLLKGESNWEIWKQYMEIALNGIDPSYW
FT                   PLLIGQDKRPTNLPGMEDSEVDFEDAVTEIDDDTPAHPTAAFATQPTQPTTTKAAIAKR
FT                   KKAQQAWDQKNAIVLSYVASSLDATMLLYFRGGHTAALVYEELRSLYEGKIFFSIRNKV
FT                   TKWATWKYKAGTKPEEFVTEWRHLFTEMQVALPIEQRVSSLYAIYVFLHAVSNNTACQH
FT                   WLNTVSIHDDWSYDEILHNIFGVFIASEGRRIRNDGQLQKQQASANIASADNNKKKKKK
FT                   DNPKGEKEEDKQTKKQYCPFHKRETIHKPKDCFLNPKKKDKSESASMENLWC"
     MAESRGGPSN PKFSDLVPLL KGESNWEIWK QYMEIALNGI DPSYWPLLIG QDKRPTNLPG        60
     MEDSEVDFED AVTEIDDDTP AHPTAAFATQ PTQPTTTKAA IAKRKKAQQA WDQKNAIVLS       120
     YVASSLDATM LLYFRGGHTA ALVYEELRSL YEGKIFFSIR NKVTKWATWK YKAGTKPEEF       180
     VTEWRHLFTE MQVALPIEQR VSSLYAIYVF LHAVSNNTAC QHWLNTVSIH DDWSYDEILH       240
     NIFGVFIASE GRRIRNDGQL QKQQASANIA SADNNKKKKK KDNPKGEKEE DKQTKKQYCP       300
     FHKRETIHKP KDCFLNPKKK DKSESASMEN LWC                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page