(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01940

AM920435.PC20G01940  Location/Qualifiers
FT   CDS             complement(join(442505..443241,443288..443385,
FT                   443444..443508,443557..443768,443824..443920))
FT                   /gene="Pc20g01940"
FT                   /locus_tag="PCH_Pc20g01940"
FT                   /note="Title: strong similarity to endo-beta-1,4-glucanase
FT                   A eglA - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85523"
FT                   /db_xref="GOA:B6HE68"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE68"
FT                   /inference="similar to AA sequence:TREMBL:AB009402.1"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /inference="protein motif:PFAM:PF00734"
FT                   /inference="protein motif:COGS:COG2730"
FT                   /inference="protein motif:COGS:COG2723"
FT                   /protein_id="CAP85523.1"
FT                   /translation="MRFISLLSIAGVTGLVLAAPGPSLSKRAGSFVWFGANEAGAEFGS
FT                   GNIPGELGTDYIWPSTSTIQTLRDAGMNLFRIPFAMERLVPGTLTSSMDATYLASLKST
FT                   VNYVTSSGGYAVIDPHNFGRYYGNIITSTSDFAAFWTALASEFASNDKVIFDTNNEFHS
FT                   QDQTLVLNLNQAAINAIRAAGAKSQYIFVEGNSWSGAWTWTTVNDNMKALTDPQDLIIY
FT                   EMHQYLDSDGSGTSETCVSSTIGRERVVAATQWLKDNGKRAFLGEFAGGANPVCQSAVT
FT                   GMLDYLQANSDVWVGASWWSAGPWWGNYMYSLELPSGVGYTYYMSLLRNYFPGSTGSGG
FT                   TTTAAPTSTPTVATATKTTTTGSSTTGAAHYAQCGGKSWTGATTCASPYACQKQSDYYS
FT                   QCL"
     MRFISLLSIA GVTGLVLAAP GPSLSKRAGS FVWFGANEAG AEFGSGNIPG ELGTDYIWPS        60
     TSTIQTLRDA GMNLFRIPFA MERLVPGTLT SSMDATYLAS LKSTVNYVTS SGGYAVIDPH       120
     NFGRYYGNII TSTSDFAAFW TALASEFASN DKVIFDTNNE FHSQDQTLVL NLNQAAINAI       180
     RAAGAKSQYI FVEGNSWSGA WTWTTVNDNM KALTDPQDLI IYEMHQYLDS DGSGTSETCV       240
     SSTIGRERVV AATQWLKDNG KRAFLGEFAG GANPVCQSAV TGMLDYLQAN SDVWVGASWW       300
     SAGPWWGNYM YSLELPSGVG YTYYMSLLRN YFPGSTGSGG TTTAAPTSTP TVATATKTTT       360
     TGSSTTGAAH YAQCGGKSWT GATTCASPYA CQKQSDYYSQ CL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page