(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01970

AM920435.PC20G01970  Location/Qualifiers
FT   CDS             448041..449630
FT                   /gene="Pc20g01970"
FT                   /locus_tag="PCH_Pc20g01970"
FT                   /note="unknown EC_number=3.2.1.91"
FT                   /note="Title: strong similarity to 1,4-beta-D-glucan
FT                   cellobiohydrolase B precursor cbhB - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85526"
FT                   /db_xref="GOA:B6HE71"
FT                   /db_xref="InterPro:IPR000254"
FT                   /db_xref="InterPro:IPR001722"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035971"
FT                   /db_xref="InterPro:IPR037019"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE71"
FT                   /inference="similar to AA sequence:TREMBL:AF156269.1"
FT                   /inference="protein motif:PFAM:PF00840"
FT                   /inference="protein motif:PFAM:PF00734"
FT                   /protein_id="CAP85526.1"
FT                   /translation="MASALSFKIYKNALLLAAFLGAAQAQQVGTSTAEVHPSLTWQKCT
FT                   AGGSCTSQSGKVVIDSNWRWVHNTGGYTNCYTGNDWDRTLCPDDVTCATNCALDGADYK
FT                   GTYGVTASGSSLRLNFVTQASQKNIGSRLYLMADDSKYEMFQLLNQEFTFDVDVSNLPC
FT                   GLNGALYFVAMDEDGGMARYPTNKAGAKYGTGYCDAQCPRDLKFINGQANVEGWEPSSS
FT                   DVNGGTGSYGSCCAEMDIWEANSISTAFTPHPCDDPAQTRCTGDSCGGTYSSDRYGGTC
FT                   DPDGCDFNPYRMGNQSFYGPSKIVDTESPFTVVTQFITNDGTSTGTLSEIKRFYVQNGK
FT                   VIPQSVSTISAVTGNSITDSFCSAQKTAFKDTDVFAKHGGMAGMGAGLAEGMVLVMSLW
FT                   DDHAANMLWLDSTYPTSASSTTPGAARGSCDISSGEPSDVEANHPNAYVVYSNIKVGPL
FT                   GSTFGSTDSGSGTTTTKVTTTTATKTTTTTGPSTTGAAHYAQCGGQNWTGPTTCASPYT
FT                   CQKQGDYYSQCL"
     MASALSFKIY KNALLLAAFL GAAQAQQVGT STAEVHPSLT WQKCTAGGSC TSQSGKVVID        60
     SNWRWVHNTG GYTNCYTGND WDRTLCPDDV TCATNCALDG ADYKGTYGVT ASGSSLRLNF       120
     VTQASQKNIG SRLYLMADDS KYEMFQLLNQ EFTFDVDVSN LPCGLNGALY FVAMDEDGGM       180
     ARYPTNKAGA KYGTGYCDAQ CPRDLKFING QANVEGWEPS SSDVNGGTGS YGSCCAEMDI       240
     WEANSISTAF TPHPCDDPAQ TRCTGDSCGG TYSSDRYGGT CDPDGCDFNP YRMGNQSFYG       300
     PSKIVDTESP FTVVTQFITN DGTSTGTLSE IKRFYVQNGK VIPQSVSTIS AVTGNSITDS       360
     FCSAQKTAFK DTDVFAKHGG MAGMGAGLAE GMVLVMSLWD DHAANMLWLD STYPTSASST       420
     TPGAARGSCD ISSGEPSDVE ANHPNAYVVY SNIKVGPLGS TFGSTDSGSG TTTTKVTTTT       480
     ATKTTTTTGP STTGAAHYAQ CGGQNWTGPT TCASPYTCQK QGDYYSQCL                   529
//

If you have problems or comments...

PBIL Back to PBIL home page