(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01980

AM920435.PC20G01980  Location/Qualifiers
FT   CDS             complement(join(450033..450084,450140..450215,
FT                   450271..450387,450442..450616,450669..451553,
FT                   451604..452113))
FT                   /gene="Pc20g01980"
FT                   /locus_tag="PCH_Pc20g01980"
FT                   /note="unknown EC_number=1.14.13.7"
FT                   /note="Title: strong similarity to phenol 2-monooxygenase
FT                   -Trichosporon beigelii"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01980"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85527"
FT                   /db_xref="GOA:B6HE72"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE72"
FT                   /inference="similar to AA sequence:PIR:A47012"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /inference="protein motif:COGS:COG0644"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /protein_id="CAP85527.1"
FT                   /translation="MEQVDVLICGSGSAGLCAATWLAKYGVRCKVLERRGGPMKMGQAD
FT                   GVQCRTVEIFESFGIGEELLREAYHVLEVNFWADNGTGAIKRTGRTADTQPGLSHQPHV
FT                   ILNQARINGLLIELMQKYNDQQIDYGYNVTDVKVDSTSAEDHDTYPVKVTAEKDGKTER
FT                   FAAKYALACDGAHSIVRKALGYKMIGDSSDAVWGVMDMVPRTNFPDIRKKSTIRSKSGN
FT                   ILIIPREGDSDNLTRFYIELAPGTNPKEVTLENLQAQAQSIFRPYRVDFVETVWWSAYA
FT                   IGQRHADFFHKDYRVFLAGDACHTHSPKAGQGMNVSLQDGYNIGWKLGEVLTGLATPSL
FT                   LETYVLERQKVAIDLITFDRYFSKLFSSGATTSPAEFQEGFIKSGKYTAGLTAKYEASP
FT                   ITSALASTNLASNVAVGMRLPSAQVVRFCDSKPLHLMKSLKSDGRWRIMAFIGDLTVLE
FT                   NRSKLNKLGDYLSAADGPIQTFTPKDQDIDSLIETIIIGHGKRHDVELEQIPECFYPVS
FT                   GKNQTRDLHKIYYDDESYNDGHGHAYEYLGIDPAQGALIIVRPDQYVSAVMGLGDHSEI
FT                   GKFFAGFLKRQTENDSSWQTSSPVGSRL"
     MEQVDVLICG SGSAGLCAAT WLAKYGVRCK VLERRGGPMK MGQADGVQCR TVEIFESFGI        60
     GEELLREAYH VLEVNFWADN GTGAIKRTGR TADTQPGLSH QPHVILNQAR INGLLIELMQ       120
     KYNDQQIDYG YNVTDVKVDS TSAEDHDTYP VKVTAEKDGK TERFAAKYAL ACDGAHSIVR       180
     KALGYKMIGD SSDAVWGVMD MVPRTNFPDI RKKSTIRSKS GNILIIPREG DSDNLTRFYI       240
     ELAPGTNPKE VTLENLQAQA QSIFRPYRVD FVETVWWSAY AIGQRHADFF HKDYRVFLAG       300
     DACHTHSPKA GQGMNVSLQD GYNIGWKLGE VLTGLATPSL LETYVLERQK VAIDLITFDR       360
     YFSKLFSSGA TTSPAEFQEG FIKSGKYTAG LTAKYEASPI TSALASTNLA SNVAVGMRLP       420
     SAQVVRFCDS KPLHLMKSLK SDGRWRIMAF IGDLTVLENR SKLNKLGDYL SAADGPIQTF       480
     TPKDQDIDSL IETIIIGHGK RHDVELEQIP ECFYPVSGKN QTRDLHKIYY DDESYNDGHG       540
     HAYEYLGIDP AQGALIIVRP DQYVSAVMGL GDHSEIGKFF AGFLKRQTEN DSSWQTSSPV       600
     GSRL                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page