(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01990

AM920435.PC20G01990  Location/Qualifiers
FT   CDS             complement(join(452537..452826,452887..453218,
FT                   453274..453661,453715..453868))
FT                   /exception="reasons given in citation"
FT                   /gene="Pc20g01990"
FT                   /locus_tag="PCH_Pc20g01990"
FT                   /note="putative sequencing error"
FT                   /note="unknown EC_number=3.1.3.16"
FT                   /note="Title: strong similarity to cell shape control
FT                   protein phosphatase ppe1p - Schizosaccharomyces pombe
FT                   [putative sequencing error]"
FT                   /db_xref="GOA:B6HE73"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR041577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE73"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /inference="protein motif:COGS:COG0639"
FT                   /protein_id="CAP85528.1"
FT                   /translation="GKYEXLTIPFRLYNTLATFXILINKTLXLFLGRIVVIYLDDILVF
FT                   LDTEDKYYKHLEEVLKCLRKXKLYAKPKKCILITIELEFYSYIISNREVRLLPEKLEAI
FT                   IGXLRLININEVRRFIRLVLYYRRFIYSFSEIAAPLYNLTKEANKELYKKRFRPINXIE
FT                   XCEVTFRRLKEVLISAPILIXLDXAKPFIIETDTLEXAISFVLGXEAKDRKVYLIAFDS
FT                   RKLRAAELNYLVYKKELLVIKEALRIXDRYLENGTTTTIIIDYKGLXYLTTI"
     MPESKIPQPG PAKLKRNAGP DEWLEAAKDC KYLSEPHMKQ LCEIVKEYMM EESNIQPVST        60
     PVTVCGDIHG QFYDLLELFR VSGGMPDGTE LDPPKTSPSV ITSADIEPPS SISDPKIRKK       120
     LRGPTVNSND EEEDSSSRSR SASDTSADLQ LNRNFVFLGD YVDRGYFSLE TLTLLLCLKA       180
     KYPDRVTLVR GNHESRQITQ VYGFYEECFQ KYGSASVWKA CCQVFDFMTL GAIIDGKVLC       240
     VHGGLSPEIR TLDQVRVVAR AQEIPHEGAF CDLVWSDPDD VETWAVSPRG AGWLFGDRVA       300
     DEFCHVNDLS LIARAHQLVN EGYKYHFNNQ NVVTVWSAPN YCYRCGNLAS VCEIGEDLKP       360
     TFKLFSAVSD DQRHVPTSRP GRSEYFL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page