(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02010

AM920435.PC20G02010  Location/Qualifiers
FT   CDS             complement(join(456392..456747,456800..457273,
FT                   457333..457585))
FT                   /gene="Pc20g02010"
FT                   /locus_tag="PCH_Pc20g02010"
FT                   /note="unknown EC_number=5.5.1.5"
FT                   /note="Title: strong similarity to carboxy-cis,cis-muconate
FT                   cyclase CMLE - Neurospora crassa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02010"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85530"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE75"
FT                   /inference="similar to AA sequence:SWISSPROT:CCCM_NEUCR"
FT                   /inference="protein motif:COGS:COG2706"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85530.1"
FT                   /translation="MKHHLMVGTWTAPGRIYTVQFDDDALTLELVKKTEIPEAEPISWM
FT                   TFSHDKKAIYGAAMKKWNSFAVNSPTEIVHQVSHPVAGHPLAPSSETNTRAIFVLAAHK
FT                   PPYNVYGNPFYNHAGYGNVFSVKPDGGLDRNIQNYEYLPNTGIHGMVFDPTETYLYSAD
FT                   LTANKIWTHIKDPKTGELALVDCLDAPDAGDHPRWVEMHPSGKYLYALMEAGNRLAVYV
FT                   IDERTHKPVFTHITYPLLPSGLPPRNKYRGDVTFCTKGGEYLFATTRSNHFDVTGYITA
FT                   FKLGPHGEIERQLFINPTSTSGGHSNAVSPCDFSDEWLALCDDQLGFVEMYRWRDEKLA
FT                   RVARVDIPEQGFGMNAIWYD"
     MKHHLMVGTW TAPGRIYTVQ FDDDALTLEL VKKTEIPEAE PISWMTFSHD KKAIYGAAMK        60
     KWNSFAVNSP TEIVHQVSHP VAGHPLAPSS ETNTRAIFVL AAHKPPYNVY GNPFYNHAGY       120
     GNVFSVKPDG GLDRNIQNYE YLPNTGIHGM VFDPTETYLY SADLTANKIW THIKDPKTGE       180
     LALVDCLDAP DAGDHPRWVE MHPSGKYLYA LMEAGNRLAV YVIDERTHKP VFTHITYPLL       240
     PSGLPPRNKY RGDVTFCTKG GEYLFATTRS NHFDVTGYIT AFKLGPHGEI ERQLFINPTS       300
     TSGGHSNAVS PCDFSDEWLA LCDDQLGFVE MYRWRDEKLA RVARVDIPEQ GFGMNAIWYD       360
//

If you have problems or comments...

PBIL Back to PBIL home page