(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02090

AM920435.PC20G02090  Location/Qualifiers
FT   CDS             complement(478705..479391)
FT                   /gene="Pc20g02090"
FT                   /locus_tag="PCH_Pc20g02090"
FT                   /note="Title: strong similarity to caYAE1 protein YAE1 like
FT                   protein An02g13390 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85538"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="InterPro:IPR038881"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE83"
FT                   /inference="protein motif:COGS:COG1859"
FT                   /protein_id="CAP85538.1"
FT                   /translation="MSTQDNPAVDNDNSLDDIFGSSPPQNTLNAPLPPTTATSQSTEPS
FT                   DLPGLRRQHVTAGYRDGTSASKGAHVQEGFDGGFPVGAQLGMRAGTVLGIMEGLLRGFE
FT                   ERNGPGVVKKPVRGQSAVSTGTDGATEIAELRRQKREQLRVLYEAALKELDVQAVFAEA
FT                   GGAPEIAPRAEDGEEERAEVQLGRKGDVVIAKWEGRVGVPGWEENMEALEMKEEGKGGG
FT                   QAVEHS"
     MSTQDNPAVD NDNSLDDIFG SSPPQNTLNA PLPPTTATSQ STEPSDLPGL RRQHVTAGYR        60
     DGTSASKGAH VQEGFDGGFP VGAQLGMRAG TVLGIMEGLL RGFEERNGPG VVKKPVRGQS       120
     AVSTGTDGAT EIAELRRQKR EQLRVLYEAA LKELDVQAVF AEAGGAPEIA PRAEDGEEER       180
     AEVQLGRKGD VVIAKWEGRV GVPGWEENME ALEMKEEGKG GGQAVEHS                    228
//

If you have problems or comments...

PBIL Back to PBIL home page