(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02100

AM920435.PC20G02100  Location/Qualifiers
FT   CDS             join(480371..481107,481142..481337)
FT                   /gene="Pc20g02100"
FT                   /locus_tag="PCH_Pc20g02100"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13400 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02100"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85539"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE84"
FT                   /protein_id="CAP85539.1"
FT                   /translation="MSRLSLRLLGFTTAATGLAGYSIHRGLCHLEEKYPALPPAAGSEA
FT                   LRKAHSPNTQHCAYTDIYAAQIPLQVIEARVPNAKTPTQTELEYAWARSVTGSKILRVE
FT                   GSLLGLLTNFRFTPCDTGNSAEGFSPDKTTGAPRILLNGLLQVQRLPATDADSNGLLVS
FT                   MELPDAPRLFFEKIARWGYPWRLMSGVRHEMSVSEPFQRNGGIFVEVRFASAHDYEVVY
FT                   AEGELEKQKIIPAWVLRLHRGYASGKLRNNAANAGYMGYLHIPDLKLPGPSVCGGISQV
FT                   MEALAYSTLTLPSRYQAYIYLTILSIESN"
     MSRLSLRLLG FTTAATGLAG YSIHRGLCHL EEKYPALPPA AGSEALRKAH SPNTQHCAYT        60
     DIYAAQIPLQ VIEARVPNAK TPTQTELEYA WARSVTGSKI LRVEGSLLGL LTNFRFTPCD       120
     TGNSAEGFSP DKTTGAPRIL LNGLLQVQRL PATDADSNGL LVSMELPDAP RLFFEKIARW       180
     GYPWRLMSGV RHEMSVSEPF QRNGGIFVEV RFASAHDYEV VYAEGELEKQ KIIPAWVLRL       240
     HRGYASGKLR NNAANAGYMG YLHIPDLKLP GPSVCGGISQ VMEALAYSTL TLPSRYQAYI       300
     YLTILSIESN                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page