(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02130

AM920435.PC20G02130  Location/Qualifiers
FT   CDS             complement(join(483216..483561,483640..485030))
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /note="Title: strong similarity to acetyl-coenzyme A
FT                   transporter like protein An02g13410 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85542"
FT                   /db_xref="GOA:B6HEA2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA2"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP85542.1"
FT                   /translation="MTRKNATLSKRRSKANLTVATGSNGRANGKMNNNIEMRRRDTPSS
FT                   ETSAERTAQLMSRTSFSLDNEPIVPQTPVQTNTTFHNLPRSDRRNFLLLVLLYFLQGIP
FT                   MGLATGSVPFLLKPYLSYGQIGIFSLASYPYSLKLFWSPIVDAVWSTRFGRRKSWITPV
FT                   QVIAGLAMIYMGGHIEEMMVQAGADGGAGVWKFTYWWFMLVLFCATQDIAVDGWAITLM
FT                   SPPNISYASTAQTVGLTAGHFLSYTVFLAFNSKDFANRWFRTIPGDGGLLSLGTYLNFW
FT                   GWAYLIVTCGLAFLKKEERTKERDSIMDVYKSMWSVLKLKNIQTIIVIHLIAKIGFQAN
FT                   DGVTSLKLLDKGFGQDNMALVVLIDFPFEIMLGYYAGQWSTNYGAMRLWGWAFVGRLAA
FT                   AVLAQLTVMIYPTASEVPMWYMLTVIGEHVLSTFMNTVMFVSISAFHARIADPAIGGTY
FT                   MTLLATVSNLGGTFPRIFVLKLVDMFTQATCLPPTIPPPADSLKDTLIMTPFSCALEPE
FT                   KNRCINGGGTCHIDRDGYYMTNILCVLIGALTFIMFIKPAAQKLQDLPLRAWRLASNPQ
FT                   RG"
     MTRKNATLSK RRSKANLTVA TGSNGRANGK MNNNIEMRRR DTPSSETSAE RTAQLMSRTS        60
     FSLDNEPIVP QTPVQTNTTF HNLPRSDRRN FLLLVLLYFL QGIPMGLATG SVPFLLKPYL       120
     SYGQIGIFSL ASYPYSLKLF WSPIVDAVWS TRFGRRKSWI TPVQVIAGLA MIYMGGHIEE       180
     MMVQAGADGG AGVWKFTYWW FMLVLFCATQ DIAVDGWAIT LMSPPNISYA STAQTVGLTA       240
     GHFLSYTVFL AFNSKDFANR WFRTIPGDGG LLSLGTYLNF WGWAYLIVTC GLAFLKKEER       300
     TKERDSIMDV YKSMWSVLKL KNIQTIIVIH LIAKIGFQAN DGVTSLKLLD KGFGQDNMAL       360
     VVLIDFPFEI MLGYYAGQWS TNYGAMRLWG WAFVGRLAAA VLAQLTVMIY PTASEVPMWY       420
     MLTVIGEHVL STFMNTVMFV SISAFHARIA DPAIGGTYMT LLATVSNLGG TFPRIFVLKL       480
     VDMFTQATCL PPTIPPPADS LKDTLIMTPF SCALEPEKNR CINGGGTCHI DRDGYYMTNI       540
     LCVLIGALTF IMFIKPAAQK LQDLPLRAWR LASNPQRG                               578
//

If you have problems or comments...

PBIL Back to PBIL home page