(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02150

AM920435.PC20G02150  Location/Qualifiers
FT   CDS             complement(join(487218..487912,487938..488898))
FT                   /gene="Pc20g02150"
FT                   /locus_tag="PCH_Pc20g02150"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13430 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02150"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85544"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA4"
FT                   /protein_id="CAP85544.1"
FT                   /translation="MESSAGPIFDEAQYRTDVLHLPSPESEAAQAQQLAEEAEQLGLKV
FT                   PEIEVSAPLAASIASGMVDLSSPVLSSGSSTDRNSMCGSLTPSHEPSSPVPSVLDQIVS
FT                   SLSDVTLSSDHIKAGSTRSLASLSTRPTSFCSSEGKPGLIGHGYNDAFEARSHRHSILS
FT                   IASADKKEKRRSSLKSAIGRIHFRKKRTSSAIVLPSDGRIAVSTSDKGVEHVFFEPTQG
FT                   PDNAAHEDVPLHASDEVSLPRLEIPRFSKEELQRSLDDPELSELHERHQMERNRHLAFH
FT                   DAALSTLRRRHQTAVSEHQSDNQRQEDERREKVRVTRFYSLVQNIQAIVQIEERQLAVE
FT                   IEQQREFDRAKMNSRTRIKHMEGYLRNASPPPSPAGTPTKAERSGRSSESFSESGSTPP
FT                   ARVLTRQHMEQLEQQYHSHKSMDQLHDARIKVLRDRQELKLQEATARMEKELDEMRNRH
FT                   IQDVAALKAEHQREESSLVQALETKKTTLQRRWYLEEAILRRHLEVRHGQSYGPLPLVT
FT                   FNTSTTPVGMAEHSPLETSSTPDTIHPSQDCVPL"
     MESSAGPIFD EAQYRTDVLH LPSPESEAAQ AQQLAEEAEQ LGLKVPEIEV SAPLAASIAS        60
     GMVDLSSPVL SSGSSTDRNS MCGSLTPSHE PSSPVPSVLD QIVSSLSDVT LSSDHIKAGS       120
     TRSLASLSTR PTSFCSSEGK PGLIGHGYND AFEARSHRHS ILSIASADKK EKRRSSLKSA       180
     IGRIHFRKKR TSSAIVLPSD GRIAVSTSDK GVEHVFFEPT QGPDNAAHED VPLHASDEVS       240
     LPRLEIPRFS KEELQRSLDD PELSELHERH QMERNRHLAF HDAALSTLRR RHQTAVSEHQ       300
     SDNQRQEDER REKVRVTRFY SLVQNIQAIV QIEERQLAVE IEQQREFDRA KMNSRTRIKH       360
     MEGYLRNASP PPSPAGTPTK AERSGRSSES FSESGSTPPA RVLTRQHMEQ LEQQYHSHKS       420
     MDQLHDARIK VLRDRQELKL QEATARMEKE LDEMRNRHIQ DVAALKAEHQ REESSLVQAL       480
     ETKKTTLQRR WYLEEAILRR HLEVRHGQSY GPLPLVTFNT STTPVGMAEH SPLETSSTPD       540
     TIHPSQDCVP L                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page