(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02220

AM920435.PC20G02220  Location/Qualifiers
FT   CDS             join(503454..503672,503810..504092,504148..504676,
FT                   504726..505053)
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /note="unknown EC_number=2.7.1.33"
FT                   /note="Title: strong similarity to pantothenate kinase panK
FT                   - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85551"
FT                   /db_xref="GOA:B6HEB0"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB0"
FT                   /inference="similar to AA sequence:TREMBL:AF098669.1"
FT                   /inference="protein motif:PFAM:PF03630"
FT                   /inference="protein motif:COGS:COG5146"
FT                   /protein_id="CAP85551.1"
FT                   /translation="MAERVEVDTRKRPNRLEAAITNPGAVKINVTGAFIVDDEPRSKSP
FT                   VDAEGVHYENKDIRLPHHTGVVSHVAVDIGGTLAKLVYFTRELDTADNGGRLNFLNFET
FT                   HRIDLCINFIRQLKEEHEKRNGSTREGLCVVATGGGAYKYYDRLKEELNVNILREEEME
FT                   CLIIGLDFFITEIPNEVFTYSDADPEPMQYAEARADVYPYLLVNIGSGVSMIKVSGPRQ
FT                   FERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADRGDNSAVDMLVGDIYGMDYTKIGL
FT                   KSTAIASTFGKVLRLKNDAEQGAEDGEGLIRDDPSEASESSKSSHGAKPNPEDMSRSLL
FT                   YAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRH
FT                   EGYLGAVGAFIRRQPQNWGRRNSVDDVVAPQAVRNLVQNNSVLQQHGRSSSDL"
     MAERVEVDTR KRPNRLEAAI TNPGAVKINV TGAFIVDDEP RSKSPVDAEG VHYENKDIRL        60
     PHHTGVVSHV AVDIGGTLAK LVYFTRELDT ADNGGRLNFL NFETHRIDLC INFIRQLKEE       120
     HEKRNGSTRE GLCVVATGGG AYKYYDRLKE ELNVNILREE EMECLIIGLD FFITEIPNEV       180
     FTYSDADPEP MQYAEARADV YPYLLVNIGS GVSMIKVSGP RQFERVGGTH LGGGTFWGIM       240
     SLLTGSRTFD DMLAMADRGD NSAVDMLVGD IYGMDYTKIG LKSTAIASTF GKVLRLKNDA       300
     EQGAEDGEGL IRDDPSEASE SSKSSHGAKP NPEDMSRSLL YAISNNIGQI AYLQSEKHSV       360
     KHIYFGGSFI RGHRQTMNTL SYAIRFWSKG EKQAYFLRHE GYLGAVGAFI RRQPQNWGRR       420
     NSVDDVVAPQ AVRNLVQNNS VLQQHGRSSS DL                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page