(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02240

AM920435.PC20G02240  Location/Qualifiers
FT   CDS             join(507964..508291,508369..508634,508968..509546)
FT                   /gene="Pc20g02240"
FT                   /locus_tag="PCH_Pc20g02240"
FT                   /note="Title: strong similarity to protein involved in
FT                   glycosylphosphatidylinositol biosynthesis pig-C - Homo
FT                   sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85553"
FT                   /db_xref="GOA:B6HEB2"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB2"
FT                   /inference="similar to AA sequence:PIR:JC4969"
FT                   /protein_id="CAP85553.1"
FT                   /translation="MASPPSLDPFPPPIPVDTHPNRATGSKPPELERSLPDPNRLAPED
FT                   AYFAPSLSRARSAPSNYEENLRSLNGDGSAHIGSTAALRKKLGGPGRRRKRKGAWKKLL
FT                   WVKQSYPDNYTDTETFLDHLQRNPRVRPYDFWPLVADSTVIVQHVCSVVIFVCCFVGIV
FT                   QDRVSPVSIVCWGSVGTAVGWILWDNWIWKEHGESRLTTVKSAFLIYFSLLGLSPILKS
FT                   LTKSTASDSIWAMSCWLLIMNIFSFDYGSGEGAGATTKFPASLSTNAAVMASTVLASRL
FT                   PSTTHVFSLMLFSMEVFGLFPIFRRQLRQKSWTGHVLLTLALVIVAGGAVGVTLSGGWA
FT                   AAIIGSVLGSILTAFVMGGCSWWLISLQKYKNVVIGPWDPARPIIRRHWN"
     MASPPSLDPF PPPIPVDTHP NRATGSKPPE LERSLPDPNR LAPEDAYFAP SLSRARSAPS        60
     NYEENLRSLN GDGSAHIGST AALRKKLGGP GRRRKRKGAW KKLLWVKQSY PDNYTDTETF       120
     LDHLQRNPRV RPYDFWPLVA DSTVIVQHVC SVVIFVCCFV GIVQDRVSPV SIVCWGSVGT       180
     AVGWILWDNW IWKEHGESRL TTVKSAFLIY FSLLGLSPIL KSLTKSTASD SIWAMSCWLL       240
     IMNIFSFDYG SGEGAGATTK FPASLSTNAA VMASTVLASR LPSTTHVFSL MLFSMEVFGL       300
     FPIFRRQLRQ KSWTGHVLLT LALVIVAGGA VGVTLSGGWA AAIIGSVLGS ILTAFVMGGC       360
     SWWLISLQKY KNVVIGPWDP ARPIIRRHWN                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page