(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02250

AM920435.PC20G02250  Location/Qualifiers
FT   CDS             join(510419..510483,510558..510850,510918..511521,
FT                   511575..511938)
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /note="unknown EC_number=3.2.1.14"
FT                   /note="Title: similarity to chitinase - Chelonus sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85554"
FT                   /db_xref="GOA:B6HEB3"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3"
FT                   /inference="similar to AA sequence:PIR:A53918"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /inference="protein motif:COGS:COG3325"
FT                   /inference="protein motif:COGS:COG3858"
FT                   /inference="protein motif:COGS:COG3469"
FT                   /protein_id="CAP85554.1"
FT                   /translation="MFKRLALGLLAAQSVAAMRFAMYHTTALPGQEKTEGIDYAIMSFA
FT                   ASKLFNSDSPAEYKPFESPETMRKRFSPDTKLMVAIGGWGDTAGFSEGAKDEASRTRYA
FT                   KNVASMLDAHGFDGVDIDWEYPGGNGQDYRQVPNEEKVDEIETYPLFLEALRKELGDKI
FT                   ISIAVPGRKQDLIAYTKEQGPKIWKSVDMVNVMSYDLTNRRDNVTNHASGVQGSLDTIN
FT                   EYLAIGADPEKLNLGFAYYAKWFTTNADSDCEENPLGCELAKLENDDGSDNGKSGALTF
FT                   EASTVAAPPKDLKDSTDGLCGFGAKTKCPSGQCCSSSGYCGTTDEFCQAGCLSDYGTCK
FT                   GISITDSWRKAQKDGKTDEKGGGQYYFDSENNLFWTWDTPEMIARKFKEIVAEKKLGGV
FT                   MAWSLGEDTYKFEHLEAMQKGIKSQSNSPKVEEPPVAERGCA"
     MFKRLALGLL AAQSVAAMRF AMYHTTALPG QEKTEGIDYA IMSFAASKLF NSDSPAEYKP        60
     FESPETMRKR FSPDTKLMVA IGGWGDTAGF SEGAKDEASR TRYAKNVASM LDAHGFDGVD       120
     IDWEYPGGNG QDYRQVPNEE KVDEIETYPL FLEALRKELG DKIISIAVPG RKQDLIAYTK       180
     EQGPKIWKSV DMVNVMSYDL TNRRDNVTNH ASGVQGSLDT INEYLAIGAD PEKLNLGFAY       240
     YAKWFTTNAD SDCEENPLGC ELAKLENDDG SDNGKSGALT FEASTVAAPP KDLKDSTDGL       300
     CGFGAKTKCP SGQCCSSSGY CGTTDEFCQA GCLSDYGTCK GISITDSWRK AQKDGKTDEK       360
     GGGQYYFDSE NNLFWTWDTP EMIARKFKEI VAEKKLGGVM AWSLGEDTYK FEHLEAMQKG       420
     IKSQSNSPKV EEPPVAERGC A                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page