(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02270

AM920435.PC20G02270  Location/Qualifiers
FT   CDS             complement(join(516004..516908,516980..517160,
FT                   517216..517612,517676..518094))
FT                   /gene="Pc20g02270"
FT                   /locus_tag="PCH_Pc20g02270"
FT                   /note="Title: strong similarity to isoamyl alcohol oxidase
FT                   mreA - Aspergillus oryzae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85556"
FT                   /db_xref="GOA:B6HEB5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB5"
FT                   /inference="similar to AA sequence:TREMBL:AB048606.1"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP85556.1"
FT                   /translation="MSPCSFMTGIFIVALLLVTHGDARAGQVSSASVAGAPLFDSEKFQ
FT                   LTDNDIAKLSQQQSALVKFGCDGTSKPTQPTRKCKVFPGDRQWPSQSVWSAFDDLLGGA
FT                   LIKTVPLAASCYSSWPQYDSDECERISSQWTDSHLHAADPASAMWPLFEGRTCLPTTNA
FT                   SASCTLGGYSSYSVNVSNVAQIQLAVNFARNADIRLVVKNTGHDFNGKSTGAGALGIWT
FT                   HNLKDIEYYENYRGSGYQGPAVKMGAGVQAFEVYAKGQELGFTAVGGEGKTVGVTGGYV
FT                   LGGGHSPMSSLYGLAADQVLALEVVLANGRFVTVTEESDPDHFWALRGGGGGTYGVVTS
FT                   LISRVYPKVGVTVSTFNFSTGKDVSVETFWAGVRSYLERFPTHADAGTYAYFWIMPTGP
FT                   NAFTFLMNPFFAVNHTVDEFNALVKPWYDDLHELGISFQPNTTYYDNFYDGWMAGFALE
FT                   TVASSTMMTGSRLFPRANWDTPTSLNATLNALRATITDGFALLAFNMKAELHEGFTSNS
FT                   ANPAWRQTLMHAITSTSWTNTTSDADIKVKMDDLTKAVGKWRAVCPDSGAYMSESDIQE
FT                   PHFQQAFYGTNYDRLYKLKQRYDPTGLFYAPTGVGSEDWVVKSLDGLPDQNGRLCRV"
     MSPCSFMTGI FIVALLLVTH GDARAGQVSS ASVAGAPLFD SEKFQLTDND IAKLSQQQSA        60
     LVKFGCDGTS KPTQPTRKCK VFPGDRQWPS QSVWSAFDDL LGGALIKTVP LAASCYSSWP       120
     QYDSDECERI SSQWTDSHLH AADPASAMWP LFEGRTCLPT TNASASCTLG GYSSYSVNVS       180
     NVAQIQLAVN FARNADIRLV VKNTGHDFNG KSTGAGALGI WTHNLKDIEY YENYRGSGYQ       240
     GPAVKMGAGV QAFEVYAKGQ ELGFTAVGGE GKTVGVTGGY VLGGGHSPMS SLYGLAADQV       300
     LALEVVLANG RFVTVTEESD PDHFWALRGG GGGTYGVVTS LISRVYPKVG VTVSTFNFST       360
     GKDVSVETFW AGVRSYLERF PTHADAGTYA YFWIMPTGPN AFTFLMNPFF AVNHTVDEFN       420
     ALVKPWYDDL HELGISFQPN TTYYDNFYDG WMAGFALETV ASSTMMTGSR LFPRANWDTP       480
     TSLNATLNAL RATITDGFAL LAFNMKAELH EGFTSNSANP AWRQTLMHAI TSTSWTNTTS       540
     DADIKVKMDD LTKAVGKWRA VCPDSGAYMS ESDIQEPHFQ QAFYGTNYDR LYKLKQRYDP       600
     TGLFYAPTGV GSEDWVVKSL DGLPDQNGRL CRV                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page