(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02280

AM920435.PC20G02280  Location/Qualifiers
FT   CDS             join(519649..519772,519836..519861,519919..519955,
FT                   520009..520082,520149..520528,520601..521126)
FT                   /gene="Pc20g02280"
FT                   /locus_tag="PCH_Pc20g02280"
FT                   /note="Title: similarity to integral membrane protein PTH11
FT                   - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85557"
FT                   /db_xref="GOA:B6HEB6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB6"
FT                   /inference="similar to AA sequence:TREMBL:AF119670.1"
FT                   /protein_id="CAP85557.1"
FT                   /translation="MIDDHHQKTALGIVVAFTILGGIAVLLRLWSRWLSRSTLTVDDYL
FT                   IVVGYILAISQSVASWYYIKTNYVGIHVWDIPKSYNPRPGLNWNFANQLLYNPALTVVK
FT                   LSILVFLRRLDSRSRVVKYLILSSYVVVISLFIAVLFVDIFQCHPVQYVYDTTIPGGKC
FT                   INQGAFFVSTAALNLFTDIMVLAIPIIITARLQMPLRRKVAVCVILCLGGVATAIGVWR
FT                   VIILAKGFLSHTPNPDATYGIGFCSSAIEVNVAVVTACGPSLKAISSRFLPRLLDSSRG
FT                   KSTYGAGTGSRTLRSNRFKSASHAQPSVHSTRGADYEMADPLGGPRVDIIGDFEMRKYK
FT                   RGESSSLSSGDDKGIMKTTDISVGYSMEPRVGDGRSQEGRPASVDSMI"
     MIDDHHQKTA LGIVVAFTIL GGIAVLLRLW SRWLSRSTLT VDDYLIVVGY ILAISQSVAS        60
     WYYIKTNYVG IHVWDIPKSY NPRPGLNWNF ANQLLYNPAL TVVKLSILVF LRRLDSRSRV       120
     VKYLILSSYV VVISLFIAVL FVDIFQCHPV QYVYDTTIPG GKCINQGAFF VSTAALNLFT       180
     DIMVLAIPII ITARLQMPLR RKVAVCVILC LGGVATAIGV WRVIILAKGF LSHTPNPDAT       240
     YGIGFCSSAI EVNVAVVTAC GPSLKAISSR FLPRLLDSSR GKSTYGAGTG SRTLRSNRFK       300
     SASHAQPSVH STRGADYEMA DPLGGPRVDI IGDFEMRKYK RGESSSLSSG DDKGIMKTTD       360
     ISVGYSMEPR VGDGRSQEGR PASVDSMI                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page