(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02340

AM920435.PC20G02340  Location/Qualifiers
FT   CDS             complement(531801..532268)
FT                   /gene="Pc20g02340"
FT                   /locus_tag="PCH_Pc20g02340"
FT                   /note="Title: similarity to 2-aminomuconate deaminase like
FT                   protein - Dictyostelium discoideum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02340"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85563"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED6"
FT                   /inference="similar to AA sequence:TREMBL:AC116305.72"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /inference="protein motif:COGS:COG0251"
FT                   /protein_id="CAP85563.1"
FT                   /translation="MSSTIPYFRPSNHAQGLANYPHARTVPSSNGQGSYIYVSGTSSRR
FT                   GDGTFVGATRTEDSAGKVTLDLDIRQQTASVLSNIHADIQAASKGKAGIHDVVDATVFL
FT                   TSINGDYSGMNEEWNRVWPDRTTAPARTTVEVRALPREEILVEIKCVAYYQ"
     MSSTIPYFRP SNHAQGLANY PHARTVPSSN GQGSYIYVSG TSSRRGDGTF VGATRTEDSA        60
     GKVTLDLDIR QQTASVLSNI HADIQAASKG KAGIHDVVDA TVFLTSINGD YSGMNEEWNR       120
     VWPDRTTAPA RTTVEVRALP REEILVEIKC VAYYQ                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page