(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02350

AM920435.PC20G02350  Location/Qualifiers
FT   CDS             complement(join(533127..534001,534057..534295,
FT                   534379..534788))
FT                   /gene="Pc20g02350"
FT                   /locus_tag="PCH_Pc20g02350"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_ii.tfa_3530wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02350"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85564"
FT                   /db_xref="GOA:B6HED7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP85564.1"
FT                   /translation="MDAVSTLWELDTLESANDYLASHGSNAPRLQHFIDGSFGRHSEPV
FT                   EWIESLNPRSGRLLAQIPSGTVTDVDRAVDAASIAFLTWSKTSRQERSQVLMRISDILG
FT                   EKKELFAVWESIDQGKTLARARVEVERAISNFRLFSLRYFATYILHEEGAVRYVDGQPF
FT                   TLTYEHRSPVGVFGLISPWNMPLYLLTWKIAPCLAFGCTGVAKPSEVTSITAFLLGEVF
FT                   RQAKLPAGVMNLVFGDGPGTGSALVKSSRVRGVSFTGGTNTGIRIRQDTVADIGKHLSL
FT                   ELGGKNPVLVFDDVDLTKAVPLAARAAFENSGQVCLCGSRIYVQRAVYAKFLSALVEYV
FT                   ESNYKLGETMGPVVSREHYLKIRGYLVQAQEENAVFHTGDVPDEEPQQGFWITPTVLTN
FT                   LPTGSRVMREEIFGPVVTVCPFGTEEEAIALANDNPNGLAGIVMTNNLARMRRVGERID
FT                   AGLIWVNCWLVRELGTGFGGMKASGTGREGGAHSRDVFTNLRTLHVSHF"
     MDAVSTLWEL DTLESANDYL ASHGSNAPRL QHFIDGSFGR HSEPVEWIES LNPRSGRLLA        60
     QIPSGTVTDV DRAVDAASIA FLTWSKTSRQ ERSQVLMRIS DILGEKKELF AVWESIDQGK       120
     TLARARVEVE RAISNFRLFS LRYFATYILH EEGAVRYVDG QPFTLTYEHR SPVGVFGLIS       180
     PWNMPLYLLT WKIAPCLAFG CTGVAKPSEV TSITAFLLGE VFRQAKLPAG VMNLVFGDGP       240
     GTGSALVKSS RVRGVSFTGG TNTGIRIRQD TVADIGKHLS LELGGKNPVL VFDDVDLTKA       300
     VPLAARAAFE NSGQVCLCGS RIYVQRAVYA KFLSALVEYV ESNYKLGETM GPVVSREHYL       360
     KIRGYLVQAQ EENAVFHTGD VPDEEPQQGF WITPTVLTNL PTGSRVMREE IFGPVVTVCP       420
     FGTEEEAIAL ANDNPNGLAG IVMTNNLARM RRVGERIDAG LIWVNCWLVR ELGTGFGGMK       480
     ASGTGREGGA HSRDVFTNLR TLHVSHF                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page