(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02370

AM920435.PC20G02370  Location/Qualifiers
FT   CDS             join(536814..536988,537065..537078,537150..537255,
FT                   537305..537567)
FT                   /gene="Pc20g02370"
FT                   /locus_tag="PCH_Pc20g02370"
FT                   /note="unknown EC_number=1.13.11.6"
FT                   /note="Title: strong similarity to 3-hydroxyanthranilic
FT                   acid dioxygenase Bna1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02370"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85566"
FT                   /db_xref="GOA:B6HED9"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6HED9"
FT                   /inference="similar to AA sequence:PIR:S57043"
FT                   /inference="protein motif:PFAM:PF06052"
FT                   /protein_id="CAP85566.1"
FT                   /translation="MEHASSAQTSIPGPVTLHSWLSANAQKLQPPVNNQCLYSGKDFIL
FT                   MAVGGPNTRNDYHINQTEEWFYQIKGDMLLKIVENGTCFRDIEIREGEMFLLPGDIPHC
FT                   PIRYEETIGLVMERTRPPHVVDRIRWYCPNADAHRTVPSIIREESFHCADIETQLKDLI
FT                   NHWMTDESTRKCGGCGEIAPPH"
     MEHASSAQTS IPGPVTLHSW LSANAQKLQP PVNNQCLYSG KDFILMAVGG PNTRNDYHIN        60
     QTEEWFYQIK GDMLLKIVEN GTCFRDIEIR EGEMFLLPGD IPHCPIRYEE TIGLVMERTR       120
     PPHVVDRIRW YCPNADAHRT VPSIIREESF HCADIETQLK DLINHWMTDE STRKCGGCGE       180
     IAPPH                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page