(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02380

AM920435.PC20G02380  Location/Qualifiers
FT   CDS             complement(join(537709..539818,539884..540038))
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SPBC530.05 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85567"
FT                   /db_xref="GOA:B6HEE0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE0"
FT                   /inference="similar to AA sequence:PIR:T40521"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP85567.1"
FT                   /translation="MNERQRVWRACQICRRKKVKCDGEHPCESCTRNQAECVYIDPSVN
FT                   MRMVDPQYLMKLERQIQLMEKRLHQQSQAQPSTGHDDQLSENVQAGEEDLDSGGAMLRS
FT                   VPRPIAANVSHSDDANHGPCLLPDQPADGLHEGPEAQQQEDVVTAPQPPEPAAIDVTRL
FT                   PEPLLRLMIDLFYRSIYPIFPIISQRDFQPQFDRWLSAHQGCLGSEDDDFLLLLYALLA
FT                   VASFLLPEEHAIFDQPHLKAYKRVDLGGLLCSHATSKFPGRPTAHNATSATNLVVAQGL
FT                   LTFYLTECGKVNDAWITVGHAIRLYQALDLENGVDAAAEVEARCGVHGNIWWCLYILDR
FT                   SLSTALLKPLAIDNSESNMDHYDGESQLTLIPEDKIDPWFAVIAEFHIIMGRIYKSVRW
FT                   IRRRHQPQNAAHGDNSMLQSYMKKYDTELQTYYTKRVLPKMEGPHSAARPLALQNVAES
FT                   SYYIGIVLLYRTFIERLKIEDPEVFLRCAEAASNCIRVTPQVMATVPASHFVIQQCRAV
FT                   YTSTKVLLHCIRMAKNTGYTNKAWPDVQRGCDMLRKTKIQWPEVKRYQQVTEEDMYLTQ
FT                   VHLSKHELFHRVFGRYGMESQIRPSGNGETNHGSPCRTRTSHTDRPQGSPGVADNDAIS
FT                   SHRDPLNNAPEVDLTRTPQSLLSHNYGQESRLPERQPKRRRLSQNFNVHPAPSPYYALN
FT                   TPPILSEADRLPMLNAAIGSSDFLLPGIPPLPSVPRDCTPDLLDDSMLMSSFDLFFSHS
FT                   E"
     MNERQRVWRA CQICRRKKVK CDGEHPCESC TRNQAECVYI DPSVNMRMVD PQYLMKLERQ        60
     IQLMEKRLHQ QSQAQPSTGH DDQLSENVQA GEEDLDSGGA MLRSVPRPIA ANVSHSDDAN       120
     HGPCLLPDQP ADGLHEGPEA QQQEDVVTAP QPPEPAAIDV TRLPEPLLRL MIDLFYRSIY       180
     PIFPIISQRD FQPQFDRWLS AHQGCLGSED DDFLLLLYAL LAVASFLLPE EHAIFDQPHL       240
     KAYKRVDLGG LLCSHATSKF PGRPTAHNAT SATNLVVAQG LLTFYLTECG KVNDAWITVG       300
     HAIRLYQALD LENGVDAAAE VEARCGVHGN IWWCLYILDR SLSTALLKPL AIDNSESNMD       360
     HYDGESQLTL IPEDKIDPWF AVIAEFHIIM GRIYKSVRWI RRRHQPQNAA HGDNSMLQSY       420
     MKKYDTELQT YYTKRVLPKM EGPHSAARPL ALQNVAESSY YIGIVLLYRT FIERLKIEDP       480
     EVFLRCAEAA SNCIRVTPQV MATVPASHFV IQQCRAVYTS TKVLLHCIRM AKNTGYTNKA       540
     WPDVQRGCDM LRKTKIQWPE VKRYQQVTEE DMYLTQVHLS KHELFHRVFG RYGMESQIRP       600
     SGNGETNHGS PCRTRTSHTD RPQGSPGVAD NDAISSHRDP LNNAPEVDLT RTPQSLLSHN       660
     YGQESRLPER QPKRRRLSQN FNVHPAPSPY YALNTPPILS EADRLPMLNA AIGSSDFLLP       720
     GIPPLPSVPR DCTPDLLDDS MLMSSFDLFF SHSE                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page