(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02400

AM920435.PC20G02400  Location/Qualifiers
FT   CDS             complement(542632..543633)
FT                   /gene="Pc20g02400"
FT                   /locus_tag="PCH_Pc20g02400"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg06586.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85569"
FT                   /db_xref="GOA:B6HEE2"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE2"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /protein_id="CAP85569.1"
FT                   /translation="MDTLPQSMKAVVIDKHGDSSVLRLETQHPLPVMNETDVLVKVHYA
FT                   GINFVDTYQRSGLYPVKLPLQVGREGAGTIVDIGSNVPPSYGLQVGNRVAVFTQGTTAE
FT                   YVSAPAESVMVLPRSVSTEQGAAIMLQGLTAWTIVQDAHKVEQGQTILIQAAAGGTGGM
FT                   LVQMCKHLGATVIGTVSTPKKAETARKHGCDHVILYKDNDVQEEVMRITSTKGCHAVLS
FT                   GVGEATFAEDLACTRRKGTLVSYGNSSGAVSSFRVLDLSKKNVKLVRPTLANYIMERDE
FT                   FVLRSQQLLDLVGSGVVRPELGGEYRLGEVAQAQDDLTTQKTTGKLLINIQT"
     MDTLPQSMKA VVIDKHGDSS VLRLETQHPL PVMNETDVLV KVHYAGINFV DTYQRSGLYP        60
     VKLPLQVGRE GAGTIVDIGS NVPPSYGLQV GNRVAVFTQG TTAEYVSAPA ESVMVLPRSV       120
     STEQGAAIML QGLTAWTIVQ DAHKVEQGQT ILIQAAAGGT GGMLVQMCKH LGATVIGTVS       180
     TPKKAETARK HGCDHVILYK DNDVQEEVMR ITSTKGCHAV LSGVGEATFA EDLACTRRKG       240
     TLVSYGNSSG AVSSFRVLDL SKKNVKLVRP TLANYIMERD EFVLRSQQLL DLVGSGVVRP       300
     ELGGEYRLGE VAQAQDDLTT QKTTGKLLIN IQT                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page