(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02420

AM920435.PC20G02420  Location/Qualifiers
FT   CDS             join(546638..547738,547804..547938)
FT                   /gene="Pc20g02420"
FT                   /locus_tag="PCH_Pc20g02420"
FT                   /note="Title: strong similarity to fluG - Aspergillus
FT                   nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02420"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85571"
FT                   /db_xref="GOA:B6HEE4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE4"
FT                   /inference="similar to AA sequence:PIR:A53186"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG0418"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85571.1"
FT                   /translation="MDDLSLLRHLIQNHPLIDHHAHNLLNPEPATDYDNYPLEAIATSA
FT                   GGRALENARTTLPSLRAASQLSELYGRPCADWNDVQSAHDESMRGDYSNLIQKSLSGTH
FT                   ALLLDDYLSDDEDIESSSWHDSFTASPTKRIVQIEAMAESTILQVSNSRKNGESVWNNF
FT                   RQRFQDALATAMEDANIVGFVSEICCRTGLDVDAYSSDDTTLGGSLIRILDSGTTKSGF
FT                   AVDDKEICDWIVQQTLKAISFKKRAGIVKPLLFHTGLGDNRINLLRANPACLQPLIAQY
FT                   PVADIVLLNAGYPYTREAGYLAATYPNVYLDLGKVFPMVSREAQMKVLRESLELAPTDR
FT                   LLWSTGGRFHPETFWLANRQFRQALETVLVDYVQNGDFMASQAMKIAADVLFYNANRLY
FT                   SLNLTPSYTAAE"
     MDDLSLLRHL IQNHPLIDHH AHNLLNPEPA TDYDNYPLEA IATSAGGRAL ENARTTLPSL        60
     RAASQLSELY GRPCADWNDV QSAHDESMRG DYSNLIQKSL SGTHALLLDD YLSDDEDIES       120
     SSWHDSFTAS PTKRIVQIEA MAESTILQVS NSRKNGESVW NNFRQRFQDA LATAMEDANI       180
     VGFVSEICCR TGLDVDAYSS DDTTLGGSLI RILDSGTTKS GFAVDDKEIC DWIVQQTLKA       240
     ISFKKRAGIV KPLLFHTGLG DNRINLLRAN PACLQPLIAQ YPVADIVLLN AGYPYTREAG       300
     YLAATYPNVY LDLGKVFPMV SREAQMKVLR ESLELAPTDR LLWSTGGRFH PETFWLANRQ       360
     FRQALETVLV DYVQNGDFMA SQAMKIAADV LFYNANRLYS LNLTPSYTAA E                411
//

If you have problems or comments...

PBIL Back to PBIL home page