(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02470

AM920435.PC20G02470  Location/Qualifiers
FT   CDS             560857..561303
FT                   /gene="Pc20g02470"
FT                   /locus_tag="PCH_Pc20g02470"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   1190_scaffold_2.tfa_630wg - Fusarium graminearum"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02470"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85576"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE9"
FT                   /inference="protein motif:COGS:COG3631"
FT                   /protein_id="CAP85576.1"
FT                   /translation="MGTKKFTAREVLDAFYKAEREYMQATPEQRDYASIAATLAPNVRM
FT                   EQTSALPYAGVYIGPDGMQDWTRRMADYFEVVDVQNPEIFERAGSEKIVVLSNVHFKVR
FT                   KTGKEMDFPFCQAITVDLERGVIVELRPFYWDVAEVNKSLGYAP"
     MGTKKFTARE VLDAFYKAER EYMQATPEQR DYASIAATLA PNVRMEQTSA LPYAGVYIGP        60
     DGMQDWTRRM ADYFEVVDVQ NPEIFERAGS EKIVVLSNVH FKVRKTGKEM DFPFCQAITV       120
     DLERGVIVEL RPFYWDVAEV NKSLGYAP                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page