(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02490

AM920435.PC20G02490  Location/Qualifiers
FT   CDS             complement(join(563880..564538,564603..564624,
FT                   564673..564764,564912..564997,565044..565180))
FT                   /gene="Pc20g02490"
FT                   /locus_tag="PCH_Pc20g02490"
FT                   /note="unknown EC_number=1.1.1.1"
FT                   /note="Title: strong similarity to alcohol dehydrogenase 2
FT                   Adh2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02490"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85578"
FT                   /db_xref="GOA:B6HEG5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG5"
FT                   /inference="similar to AA sequence:TREMBL:SCADHR2.1"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /inference="protein motif:COGS:COG1064"
FT                   /inference="protein motif:COGS:COG0604"
FT                   /inference="protein motif:COGS:COG1063"
FT                   /protein_id="CAP85578.1"
FT                   /translation="MSLPQKQLCAWVESPGPEAKIEFRDIEVPNPTAGQVLVKLEVSGV
FT                   CHSDHHSIYGNTPMTTHIAGHEGVGIVVADYLRWLHRACRKCATCEMDYTHCPHQDNSG
FT                   RNVPGTFQADADYISRIPAEVPAALAAPLLCGGITMYGALSRAELRAGDFVVIPGAGGG
FT                   LGHLGVQIATSMGFQVIAIDSGDKEDICRDSGARHFFDFRQSGASLVDDVRAAAGGIGA
FT                   HAVICITGAPSAYDSALAMLRNLGRLVCVGIPPAEYRLQLNPFEVLVRGLRVIGSTVGN
FT                   SAQMPLLMDLVLQGKVRPHVQVYTFQELRDVMDKLEHGTVAGRAVLRISD"
     MSLPQKQLCA WVESPGPEAK IEFRDIEVPN PTAGQVLVKL EVSGVCHSDH HSIYGNTPMT        60
     THIAGHEGVG IVVADYLRWL HRACRKCATC EMDYTHCPHQ DNSGRNVPGT FQADADYISR       120
     IPAEVPAALA APLLCGGITM YGALSRAELR AGDFVVIPGA GGGLGHLGVQ IATSMGFQVI       180
     AIDSGDKEDI CRDSGARHFF DFRQSGASLV DDVRAAAGGI GAHAVICITG APSAYDSALA       240
     MLRNLGRLVC VGIPPAEYRL QLNPFEVLVR GLRVIGSTVG NSAQMPLLMD LVLQGKVRPH       300
     VQVYTFQELR DVMDKLEHGT VAGRAVLRIS D                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page