(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02510

AM920435.PC20G02510  Location/Qualifiers
FT   CDS             complement(join(569035..569339,569404..569838,
FT                   569891..570179))
FT                   /gene="Pc20g02510"
FT                   /locus_tag="PCH_Pc20g02510"
FT                   /note="unknown EC_number=1.13.11.4"
FT                   /note="Title: weak similarity to gentisate 1,2-dioxygenases
FT                   xlnE - Pseudomonas alcaligenes"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02510"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85580"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG7"
FT                   /inference="protein motif:COGS:COG3435"
FT                   /inference="protein motif:COGS:COG2140"
FT                   /inference="protein motif:COGS:COG3257"
FT                   /protein_id="CAP85580.1"
FT                   /translation="MATETETVSKVEASKNVEASDQEIDTSDGLALALEKLETKPLWTQ
FT                   MTKLNPPLLNPSCVPHVWRYDQIRPSLLKAGELVNESQAERRVLMLVNPARDAPYTTDT
FT                   LYAGLQLVMPNETAQAHRHTAFAMRFIIEGQGGFTAVHGQRISMQRGDVILTPRWNWHD
FT                   HGKDGTGPMIWLDGLDLPNFRHFPVHFVEHYQHARYPADDVDSNTSPIVFPWVKMKQAL
FT                   DDTPGDWASKDYLKSDGRPVSKVLGGSAERLRAGQSSPEIRETASSVYHVVSGRGYSTI
FT                   GDSRITWGPGDTFCIPSWHRYEHFADTEEDVYLYRFHDKPMLDALGFYRVEGVDVESLV
FT                   SD"
     MATETETVSK VEASKNVEAS DQEIDTSDGL ALALEKLETK PLWTQMTKLN PPLLNPSCVP        60
     HVWRYDQIRP SLLKAGELVN ESQAERRVLM LVNPARDAPY TTDTLYAGLQ LVMPNETAQA       120
     HRHTAFAMRF IIEGQGGFTA VHGQRISMQR GDVILTPRWN WHDHGKDGTG PMIWLDGLDL       180
     PNFRHFPVHF VEHYQHARYP ADDVDSNTSP IVFPWVKMKQ ALDDTPGDWA SKDYLKSDGR       240
     PVSKVLGGSA ERLRAGQSSP EIRETASSVY HVVSGRGYST IGDSRITWGP GDTFCIPSWH       300
     RYEHFADTEE DVYLYRFHDK PMLDALGFYR VEGVDVESLV SD                          342
//

If you have problems or comments...

PBIL Back to PBIL home page