(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02520

AM920435.PC20G02520  Location/Qualifiers
FT   CDS             join(570487..570734,570769..570952,571026..571395,
FT                   571456..571565)
FT                   /gene="Pc20g02520"
FT                   /locus_tag="PCH_Pc20g02520"
FT                   /note="Title: strong similarity to hypothetical
FT                   2-hydroxyhepta-2,4-diene-1,7-dioate isomerase BH2000
FT                   -Bacillus halodurans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85581"
FT                   /db_xref="GOA:B6HEG8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG8"
FT                   /inference="similar to AA sequence:PIR:H83899"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /inference="protein motif:COGS:COG0179"
FT                   /protein_id="CAP85581.1"
FT                   /translation="MRVAWQRFIRFQAADGRILQGEPILSKPDLDLGYVTEKDRLQARV
FT                   IVGDDILDETGVTRVSDEIVTVRRILSPLAPSDVPTIRGKSTNLQELSELITAVQQAKR
FT                   TPPPFPFIFFKPQTTILDHGDNVVIPKIAQDDQADYEGELTIVIGKDAKDVSQENALDY
FT                   VAAYTVGNDISSRKLQRDPEYAGRIPQWGFSKGFDTYAPIGPCLLASSLVDDPKNLHLT
FT                   TIVDGDVRQDESVDDLLFDCRYLISYLSQGTTLQKGSIIMTGTPGGVGGDMKPPRWLQP
FT                   GTQMEVRISKIGTLRNGVVFAE"
     MRVAWQRFIR FQAADGRILQ GEPILSKPDL DLGYVTEKDR LQARVIVGDD ILDETGVTRV        60
     SDEIVTVRRI LSPLAPSDVP TIRGKSTNLQ ELSELITAVQ QAKRTPPPFP FIFFKPQTTI       120
     LDHGDNVVIP KIAQDDQADY EGELTIVIGK DAKDVSQENA LDYVAAYTVG NDISSRKLQR       180
     DPEYAGRIPQ WGFSKGFDTY APIGPCLLAS SLVDDPKNLH LTTIVDGDVR QDESVDDLLF       240
     DCRYLISYLS QGTTLQKGSI IMTGTPGGVG GDMKPPRWLQ PGTQMEVRIS KIGTLRNGVV       300
     FAE                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page