(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02560

AM920435.PC20G02560  Location/Qualifiers
FT   CDS             join(578349..578957,579028..579970,580029..580096)
FT                   /gene="Pc20g02560"
FT                   /locus_tag="PCH_Pc20g02560"
FT                   /note="Title: strong similarity to human secreted protein
FT                   fragment like protein An02g13670 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02560"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85585"
FT                   /db_xref="GOA:B6HEH2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH2"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /inference="protein motif:COGS:COG2119"
FT                   /inference="protein motif:COGS:COG0730"
FT                   /protein_id="CAP85585.1"
FT                   /translation="MKINHSSFLLFLLPAISAVLADTTYNDNIDSRVSRETAGNNARLV
FT                   DSDIVASNVAKGAPDVPVDGKDGRPHAGPWVETNADRDRKGVKGTDDIDSVSTKYDTKI
FT                   PSSEHLSTEEGKMIPHSNGGVMDDPHRAGPKEGTRGTEGGVSEKGKEGKLTSEKAPGGP
FT                   KEAPPLPHSETKKLGSDSDDTTTGTGSRSAESQGSLGMLGKPADLPEKPHDIPYPKPPA
FT                   MVKDDPLGLGHDSVASGSPSSSSSSSLTHDYDYDHDSGIPDAGSSLHSLVFSFTMILVS
FT                   EIGDKTFLVAALMAMRHPRLVVFSAAFSALILMTVLSAVLGHAVPTLIPKTFTKFMAAI
FT                   LFLIFGVKMLKEGREMSPDEGVGEEMREVEAELEEKEHEQLRMDRRRSSVTPHNLEAGR
FT                   AGGRPKTRGSGNRLPSPPESLSSSSSRGSSPQPRQRLDSIFSGLSNLFSLLLSPAWVQT
FT                   FVMTFLGEWGDRSQIATIAMAAGQDYWWVTIGASAGHGICTAAAVIGGRAIAGRVSMRV
FT                   VTLGGAVAFLVFGVIYFIEAIF"
     MKINHSSFLL FLLPAISAVL ADTTYNDNID SRVSRETAGN NARLVDSDIV ASNVAKGAPD        60
     VPVDGKDGRP HAGPWVETNA DRDRKGVKGT DDIDSVSTKY DTKIPSSEHL STEEGKMIPH       120
     SNGGVMDDPH RAGPKEGTRG TEGGVSEKGK EGKLTSEKAP GGPKEAPPLP HSETKKLGSD       180
     SDDTTTGTGS RSAESQGSLG MLGKPADLPE KPHDIPYPKP PAMVKDDPLG LGHDSVASGS       240
     PSSSSSSSLT HDYDYDHDSG IPDAGSSLHS LVFSFTMILV SEIGDKTFLV AALMAMRHPR       300
     LVVFSAAFSA LILMTVLSAV LGHAVPTLIP KTFTKFMAAI LFLIFGVKML KEGREMSPDE       360
     GVGEEMREVE AELEEKEHEQ LRMDRRRSSV TPHNLEAGRA GGRPKTRGSG NRLPSPPESL       420
     SSSSSRGSSP QPRQRLDSIF SGLSNLFSLL LSPAWVQTFV MTFLGEWGDR SQIATIAMAA       480
     GQDYWWVTIG ASAGHGICTA AAVIGGRAIA GRVSMRVVTL GGAVAFLVFG VIYFIEAIF        539
//

If you have problems or comments...

PBIL Back to PBIL home page