(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02600

AM920435.PC20G02600  Location/Qualifiers
FT   CDS             complement(join(591529..591768,591837..591941))
FT                   /gene="Pc20g02600"
FT                   /locus_tag="PCH_Pc20g02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02600"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85589"
FT                   /db_xref="GOA:B6HEH6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH6"
FT                   /protein_id="CAP85589.1"
FT                   /translation="MPRLGLRGFAVVLAVIIMSLLGALFGNTGWVYYIVVGIPGIWSLA
FT                   NLALIVFKRPVHPGAHIALDFIFTIVQLFFGIISLLAEQVSSLYGSSLHSSHSSWSMAV
FT                   AAFALMVING"
     MPRLGLRGFA VVLAVIIMSL LGALFGNTGW VYYIVVGIPG IWSLANLALI VFKRPVHPGA        60
     HIALDFIFTI VQLFFGIISL LAEQVSSLYG SSLHSSHSSW SMAVAAFALM VING             114
//

If you have problems or comments...

PBIL Back to PBIL home page