(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02690

AM920435.PC20G02690  Location/Qualifiers
FT   CDS             join(616139..616232,616335..616523,616583..616719,
FT                   616776..616904)
FT                   /gene="Pc20g02690"
FT                   /locus_tag="PCH_Pc20g02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02690"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85598"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES4"
FT                   /protein_id="CAP85598.1"
FT                   /translation="MGVGHTGLACHANHYNIQHTEYSYFPGTSCQGKGLAFPTRNDRVE
FT                   QKWGGFPSRAGTFFFKENSQRDASVRVKGGIKVGTKLPFEQDSFSFDPQRAHITRLQVE
FT                   GQAFTLNSLSTLITVYQQNIPGGFGRPPDPQPLLLSTTKYSTDIYRLSVTLTLRRGFEA
FT                   YYKIEASEIEAYNLMEIPL"
     MGVGHTGLAC HANHYNIQHT EYSYFPGTSC QGKGLAFPTR NDRVEQKWGG FPSRAGTFFF        60
     KENSQRDASV RVKGGIKVGT KLPFEQDSFS FDPQRAHITR LQVEGQAFTL NSLSTLITVY       120
     QQNIPGGFGR PPDPQPLLLS TTKYSTDIYR LSVTLTLRRG FEAYYKIEAS EIEAYNLMEI       180
     PL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page