(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02730

AM920435.PC20G02730  Location/Qualifiers
FT   CDS             join(623023..623241,623313..623532,623596..624032)
FT                   /gene="Pc20g02730"
FT                   /locus_tag="PCH_Pc20g02730"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13830 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85602"
FT                   /db_xref="GOA:B6HES8"
FT                   /db_xref="InterPro:IPR037475"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES8"
FT                   /protein_id="CAP85602.1"
FT                   /translation="MTDSSPEALAALQQLEQNGKLKDRLAIIRISDPISTEVGGSYPSP
FT                   SKRSSDASLSNFDDPTPASLEADLSHYKELFSKLRFSYLEQVTKEKFLRAIVGDPPVIV
FT                   GHNENMELETQLADVKAELKARKEDARIMIEEMEQMGRDLASRYKNVELQTTQLSTLPA
FT                   SIENLESTIAELRAKQIATMDPSDPNNSSSQNLPLPATLALLAEREAELAALNRQLAAV
FT                   HSALPRKTREAEAVERERSVLERRKSDAIAQAREAQRKKQQGESDGLEEIGRWYRGAEE
FT                   TLKELVGTQT"
     MTDSSPEALA ALQQLEQNGK LKDRLAIIRI SDPISTEVGG SYPSPSKRSS DASLSNFDDP        60
     TPASLEADLS HYKELFSKLR FSYLEQVTKE KFLRAIVGDP PVIVGHNENM ELETQLADVK       120
     AELKARKEDA RIMIEEMEQM GRDLASRYKN VELQTTQLST LPASIENLES TIAELRAKQI       180
     ATMDPSDPNN SSSQNLPLPA TLALLAEREA ELAALNRQLA AVHSALPRKT REAEAVERER       240
     SVLERRKSDA IAQAREAQRK KQQGESDGLE EIGRWYRGAE ETLKELVGTQ T                291
//

If you have problems or comments...

PBIL Back to PBIL home page