(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02760

AM920435.PC20G02760  Location/Qualifiers
FT   CDS             join(628481..628665,628716..629669,629732..629771)
FT                   /gene="Pc20g02760"
FT                   /locus_tag="PCH_Pc20g02760"
FT                   /note="Title: strong similarity to mitochondrial carrier
FT                   protein Rim2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02760"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85605"
FT                   /db_xref="GOA:B6HET1"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET1"
FT                   /inference="similar to AA sequence:PIR:S36081"
FT                   /inference="protein motif:PFAM:PF00153"
FT                   /protein_id="CAP85605.1"
FT                   /translation="MTFSTTAAPSSAPAQLGSTPPSVNKDLIPQSREMGDVIPNRTPPA
FT                   SQEKPEAKPFAHFVAGGLGGMTAATLTSPLDVLKTRLQSDFYQAQLQALRAAKPAPAPT
FT                   SNALVSVTRTAGMHFSETFQILRSIHVHEGWRALFKGLGPNLIGVVPARAINFYVYGNG
FT                   KRILSDYFDYRTAEQTPMGIHLAAAAIAGIATGTATNPIWLVKTRLQLDKSNAEIGKSR
FT                   QYRNSFDCIKQTVRHEGIRGLYRGLSASYLGVTESSLQWVMYEQMKMYLARRDALKQAD
FT                   PAYDYTSWDSAELWGGRITAAGLAKLVAAAITYPHEVVRTRLRQAPTVSLGNGKVEMKY
FT                   TGLVQCFKTVWKEEGMVAMYGGLTPHLLRVVPSAAIMFGMYEFILRMFGTTS"
     MTFSTTAAPS SAPAQLGSTP PSVNKDLIPQ SREMGDVIPN RTPPASQEKP EAKPFAHFVA        60
     GGLGGMTAAT LTSPLDVLKT RLQSDFYQAQ LQALRAAKPA PAPTSNALVS VTRTAGMHFS       120
     ETFQILRSIH VHEGWRALFK GLGPNLIGVV PARAINFYVY GNGKRILSDY FDYRTAEQTP       180
     MGIHLAAAAI AGIATGTATN PIWLVKTRLQ LDKSNAEIGK SRQYRNSFDC IKQTVRHEGI       240
     RGLYRGLSAS YLGVTESSLQ WVMYEQMKMY LARRDALKQA DPAYDYTSWD SAELWGGRIT       300
     AAGLAKLVAA AITYPHEVVR TRLRQAPTVS LGNGKVEMKY TGLVQCFKTV WKEEGMVAMY       360
     GGLTPHLLRV VPSAAIMFGM YEFILRMFGT TS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page