(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02780

AM920435.PC20G02780  Location/Qualifiers
FT   CDS             join(635679..636186,636241..636397,636462..636714)
FT                   /gene="Pc20g02780"
FT                   /locus_tag="PCH_Pc20g02780"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   PA3829 - Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02780"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85607"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET3"
FT                   /inference="similar to AA sequence:PIR:B83167"
FT                   /inference="protein motif:COGS:COG1073"
FT                   /inference="protein motif:COGS:COG0596"
FT                   /inference="protein motif:COGS:COG1506"
FT                   /protein_id="CAP85607.1"
FT                   /translation="MSRENVEFQTADHVTLRGWFFRPSMEPLETKLPCLVMSHGFSALK
FT                   EMGLDAFAEYFALNLPISCLVYDNRGFGDSDTKEGQPRQEVLPSQQISDISDAITYAQS
FT                   RADVDPNRIGIWGSSYSGGHVLYVGAVDRRVKVVLSHVPFTDGWETLSRLLPSDAIDGV
FT                   NKAFQEDRLARAAGKPAGMIAVVEKDPLKPSTLPTPDSYQFFSEWEAKSNWKNEITLKS
FT                   LEAARGYNPTAHIHHISPTPLLMTVAENDVVAPTDIALDAYSRAGEPKKLRMFPGGHFD
FT                   GYAGEGFERNASVHAEFLKEHLVG"
     MSRENVEFQT ADHVTLRGWF FRPSMEPLET KLPCLVMSHG FSALKEMGLD AFAEYFALNL        60
     PISCLVYDNR GFGDSDTKEG QPRQEVLPSQ QISDISDAIT YAQSRADVDP NRIGIWGSSY       120
     SGGHVLYVGA VDRRVKVVLS HVPFTDGWET LSRLLPSDAI DGVNKAFQED RLARAAGKPA       180
     GMIAVVEKDP LKPSTLPTPD SYQFFSEWEA KSNWKNEITL KSLEAARGYN PTAHIHHISP       240
     TPLLMTVAEN DVVAPTDIAL DAYSRAGEPK KLRMFPGGHF DGYAGEGFER NASVHAEFLK       300
     EHLVG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page