(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02810

AM920435.PC20G02810  Location/Qualifiers
FT   CDS             join(645620..645704,645774..645832,645897..645924,
FT                   646001..646041)
FT                   /gene="Pc20g02810"
FT                   /locus_tag="PCH_Pc20g02810"
FT                   /note="Title: similarity to translocation complex component
FT                   Sss1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02810"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85610"
FT                   /db_xref="GOA:B6HET6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET6"
FT                   /inference="similar to AA sequence:PIR:S48775"
FT                   /inference="protein motif:PFAM:PF00584"
FT                   /inference="protein motif:COGS:COG2443"
FT                   /protein_id="CAP85610.1"
FT                   /translation="MSETLQELADIPKDFVREGSQFVRRCTKPDKREFIKISQAVGMGF
FT                   LVMGAIGYFVKLIHIPVNQVLVGGA"
     MSETLQELAD IPKDFVREGS QFVRRCTKPD KREFIKISQA VGMGFLVMGA IGYFVKLIHI        60
     PVNQVLVGGA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page