(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02820

AM920435.PC20G02820  Location/Qualifiers
FT   CDS             complement(join(646678..646877,646981..647746,
FT                   647807..648172,648247..648623,648680..648778,
FT                   648841..649144))
FT                   /gene="Pc20g02820"
FT                   /locus_tag="PCH_Pc20g02820"
FT                   /note="Title: strong similarity to cDNA LEC14B
FT                   -Lithospermum erythrorhizon"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02820"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85611"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET7"
FT                   /inference="similar to AA sequence:SWISSPROT:L14B_PRUAR"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /inference="protein motif:COGS:COG5635"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /protein_id="CAP85611.1"
FT                   /translation="MNDITQNQPVTEVGTYLCTISIHGSLLISTTTIQNMSSRTPDDGT
FT                   ESSRGSEGIWHPAHEWLENDELDTDYHPALEPSEHDGAWEDDIPNEDQQMGSGVASENT
FT                   HINIGNIQIELTADDSESEDTDDLNEGHTRVPASRLFELLASSGLQHILQANGWPTAME
FT                   EEQETLEDEDDELSDEDFMPIFRNRLRARRSTETLKLPPVPNPEGKKLMSEGHFGTDQF
FT                   YGDRLRQRKKFLATSLMWRELGIDTDGVRKRAGQSISQGLIPSSIADKIIHYDTRSYSG
FT                   QFSDDGNFFFCCAQDFKVRMYDTSNPYDWKYYKTVDYPFGQWTITDATLSPDNRFLVYS
FT                   SIRSQAYMASTDPEDNSDPTVLDLSTPPGQRRRRSWGSSHFGIWSLRFSGDGREVVAGT
FT                   SEDSVIVYDLETRQPVLNLRERHQHHVNAVCYGDTSSPHILYSGSDDTTIRVWDRRSMG
FT                   DGREAGAFMGHTEGLTYVDSKGDGRYVLSNSKDQTMKLWDLRKMMTSADIENIDPFDYS
FT                   TGFDYRFEQYPDQYRRNAKNDCSVVTYRGHRVLKTLIRCHFSPPGSTNSRYVYSGSEDG
FT                   KVYVYNLDATLAGTIDVGQATFNSRPRDPDAYATAYEMSGEMLWRTCVRDASWHPNAPV
FT                   LAVHSWNAGAAKDEGDPPAGKSYDDRLRHIPEFDQYRESAPHGRPRRPLRSRPVRRWVG
FT                   DEEAEDAIW"
     MNDITQNQPV TEVGTYLCTI SIHGSLLIST TTIQNMSSRT PDDGTESSRG SEGIWHPAHE        60
     WLENDELDTD YHPALEPSEH DGAWEDDIPN EDQQMGSGVA SENTHINIGN IQIELTADDS       120
     ESEDTDDLNE GHTRVPASRL FELLASSGLQ HILQANGWPT AMEEEQETLE DEDDELSDED       180
     FMPIFRNRLR ARRSTETLKL PPVPNPEGKK LMSEGHFGTD QFYGDRLRQR KKFLATSLMW       240
     RELGIDTDGV RKRAGQSISQ GLIPSSIADK IIHYDTRSYS GQFSDDGNFF FCCAQDFKVR       300
     MYDTSNPYDW KYYKTVDYPF GQWTITDATL SPDNRFLVYS SIRSQAYMAS TDPEDNSDPT       360
     VLDLSTPPGQ RRRRSWGSSH FGIWSLRFSG DGREVVAGTS EDSVIVYDLE TRQPVLNLRE       420
     RHQHHVNAVC YGDTSSPHIL YSGSDDTTIR VWDRRSMGDG REAGAFMGHT EGLTYVDSKG       480
     DGRYVLSNSK DQTMKLWDLR KMMTSADIEN IDPFDYSTGF DYRFEQYPDQ YRRNAKNDCS       540
     VVTYRGHRVL KTLIRCHFSP PGSTNSRYVY SGSEDGKVYV YNLDATLAGT IDVGQATFNS       600
     RPRDPDAYAT AYEMSGEMLW RTCVRDASWH PNAPVLAVHS WNAGAAKDEG DPPAGKSYDD       660
     RLRHIPEFDQ YRESAPHGRP RRPLRSRPVR RWVGDEEAED AIW                         703
//

If you have problems or comments...

PBIL Back to PBIL home page