(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02830

AM920435.PC20G02830  Location/Qualifiers
FT   CDS             complement(join(649471..649644,649689..649763,
FT                   649890..649928,650033..650236,650317..650414,
FT                   650480..650531))
FT                   /gene="Pc20g02830"
FT                   /locus_tag="PCH_Pc20g02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02830"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85612"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF44"
FT                   /protein_id="CAP85612.1"
FT                   /translation="MRLSNHLILFSTHLALSIAAGCGDADACVGTEICTTATFTTPTAT
FT                   TITTCRIVSPAVRAKSAAPHTVRPLNVDRLTQTGRTARRIMAHVWQMRTAATETSVWTD
FT                   FVLDLESRLSRELVVNVALELPNCPNYLSLYYPSGRTTIHCNGEPKPIPIERNIHIQKP
FT                   EIRLLQASVFQHIMRSSWFLKGQLSSTPYGNNAIPSHQSHRAGAGNTKWV"
     MRLSNHLILF STHLALSIAA GCGDADACVG TEICTTATFT TPTATTITTC RIVSPAVRAK        60
     SAAPHTVRPL NVDRLTQTGR TARRIMAHVW QMRTAATETS VWTDFVLDLE SRLSRELVVN       120
     VALELPNCPN YLSLYYPSGR TTIHCNGEPK PIPIERNIHI QKPEIRLLQA SVFQHIMRSS       180
     WFLKGQLSST PYGNNAIPSH QSHRAGAGNT KWV                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page