(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02860

AM920435.PC20G02860  Location/Qualifiers
FT   CDS             complement(join(654576..655497,655553..655582,
FT                   655642..656690))
FT                   /gene="Pc20g02860"
FT                   /locus_tag="PCH_Pc20g02860"
FT                   /note="Title: similarity to hypothetical myb-like DNA
FT                   binding protein SPAC13G7.10 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02860"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85615"
FT                   /db_xref="GOA:B6HF47"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF47"
FT                   /inference="protein motif:PFAM:PF00249"
FT                   /protein_id="CAP85615.1"
FT                   /translation="MESSSALRPLDESLLRELPQLSLRIAPLREPVSSRTLSVPSPLEP
FT                   NASGARDSNNISNSSSNSGKIQANAKEGLPTVTEFLNAARIRKTELSADSQSNVERPPR
FT                   PILPAFVNLRALEKFPFSSSFDDDALQGPRKRRRRDPQPDSFSEHLQLPIPQAQKEQRP
FT                   PPFGPFAILNGLNEPPPNAALLPPIEAGSNISQLLNKPSRGDAAADSGTSVSAHAAISD
FT                   GQPAERRDTRLEDILRTSLNADGDHDQNDNAENVQSTNPVDPDEIALAVREAEKLKDSK
FT                   ESPLPPAADAPMSPKTRGRSRKNLRKWSEEETTNLLRGVIKCGIGNWTAILAQPELKFN
FT                   QRTASNLKDRFRVLCPWAYSASDPDLAAKQLHDTLANSLLKAKAEGSDESPSKLHLSHL
FT                   IPSNFEPNFGAGSPACNPQEPLISSTAPDTDPRGSTTAQSQSPSSGNSTPALSSKSRTT
FT                   LASLGIPEPHVSRTKRRSRRPFTAAEDEALLKGYAVHGFQWTLIQQDSRLNLSHRKATD
FT                   LRDRFRTKFPHAYRDGGSVSGKALTSQNQAQESAVGTSTPRPHAGTEQSPSKAYAMTPT
FT                   QTPATTPRTSVSRSRHAATPSQSNPAQIDPALLPPPPQGFLEHSMYLPPAAAAGALSFS
FT                   LDDGPGTGASSAVETPWEDNTLAPMIWDELT"
     MESSSALRPL DESLLRELPQ LSLRIAPLRE PVSSRTLSVP SPLEPNASGA RDSNNISNSS        60
     SNSGKIQANA KEGLPTVTEF LNAARIRKTE LSADSQSNVE RPPRPILPAF VNLRALEKFP       120
     FSSSFDDDAL QGPRKRRRRD PQPDSFSEHL QLPIPQAQKE QRPPPFGPFA ILNGLNEPPP       180
     NAALLPPIEA GSNISQLLNK PSRGDAAADS GTSVSAHAAI SDGQPAERRD TRLEDILRTS       240
     LNADGDHDQN DNAENVQSTN PVDPDEIALA VREAEKLKDS KESPLPPAAD APMSPKTRGR       300
     SRKNLRKWSE EETTNLLRGV IKCGIGNWTA ILAQPELKFN QRTASNLKDR FRVLCPWAYS       360
     ASDPDLAAKQ LHDTLANSLL KAKAEGSDES PSKLHLSHLI PSNFEPNFGA GSPACNPQEP       420
     LISSTAPDTD PRGSTTAQSQ SPSSGNSTPA LSSKSRTTLA SLGIPEPHVS RTKRRSRRPF       480
     TAAEDEALLK GYAVHGFQWT LIQQDSRLNL SHRKATDLRD RFRTKFPHAY RDGGSVSGKA       540
     LTSQNQAQES AVGTSTPRPH AGTEQSPSKA YAMTPTQTPA TTPRTSVSRS RHAATPSQSN       600
     PAQIDPALLP PPPQGFLEHS MYLPPAAAAG ALSFSLDDGP GTGASSAVET PWEDNTLAPM       660
     IWDELT                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page