(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02890

AM920435.PC20G02890  Location/Qualifiers
FT   CDS             complement(join(661670..661729,661767..661906,
FT                   662126..662252))
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85618"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF50"
FT                   /protein_id="CAP85618.1"
FT                   /translation="MEGGEQNNLIDPNSILALGRPTFGSPLGILGIRFACSKRHTVVSP
FT                   RRTNGHIIWGMHNNAVVDYFLTVTPGTRNIERNILLPKVPNWSILELGSGSGILCITLH
FT                   FPLL"
     MEGGEQNNLI DPNSILALGR PTFGSPLGIL GIRFACSKRH TVVSPRRTNG HIIWGMHNNA        60
     VVDYFLTVTP GTRNIERNIL LPKVPNWSIL ELGSGSGILC ITLHFPLL                    108
//

If you have problems or comments...

PBIL Back to PBIL home page