(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02900

AM920435.PC20G02900  Location/Qualifiers
FT   CDS             complement(join(664188..664241,664296..664590,
FT                   664723..665007,665076..665213,665360..665370))
FT                   /gene="Pc20g02900"
FT                   /locus_tag="PCH_Pc20g02900"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit S4.e - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02900"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85619"
FT                   /db_xref="GOA:B6HF51"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018199"
FT                   /db_xref="InterPro:IPR032277"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF51"
FT                   /inference="similar to AA sequence:PIR:S20054"
FT                   /inference="protein motif:PFAM:PF00900"
FT                   /inference="protein motif:COGS:COG1471"
FT                   /protein_id="CAP85619.1"
FT                   /translation="MRGPGKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIV
FT                   FIRNRLKYALNGREVKAIMMQRLVKVDGKVRTDTTYPAGFMDVISLEKTGEHFRLIYDT
FT                   KGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDI
FT                   ATGKILDFVKFDSGVVIMATGGRNMGRVGVITHRERHDGGFNIVHVRDALDNQFATRES
FT                   NVFVIGQDKPWVSLPKGKGVKLSIAEERDRRRAHDLAN"
     MRGPGKHQKR LSAPSHWLLD KMSGTYAPKA SPGPHKLRDC LPLIVFIRNR LKYALNGREV        60
     KAIMMQRLVK VDGKVRTDTT YPAGFMDVIS LEKTGEHFRL IYDTKGRFTV HRIQAEEAEY       120
     KLCKVKRVQL GKGGIPFLVT HDARTIRYPD PAIKVNDTVK VDIATGKILD FVKFDSGVVI       180
     MATGGRNMGR VGVITHRERH DGGFNIVHVR DALDNQFATR ESNVFVIGQD KPWVSLPKGK       240
     GVKLSIAEER DRRRAHDLAN                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page